Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004413000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • putative secreted propeptide peptidase
    • peptidase propeptide and YPEB domain-containing protein
    • propeptide, pepSY amd peptidase M4
  • strand?: +
  • coordinates?: 4659912..4661276
  • synteny block?: BlockID0034170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1704
    08BA02176:
    C248_1791
    11819-97:
    MS7_1752
    71193:
    ST398NM01_1799
    ECT-R 2:
    ECTR2_1586
    ED133:
    SAOV_1732
    ED98:
    SAAV_1756
    HO 5096 0412:
    SAEMRSA15_16540
    JH1:
    SaurJH1_1836
    JH9:
    SaurJH9_1801
    JKD6008:
    SAA6008_01717
    JKD6159:
    SAA6159_01669
    LGA251:
    SARLGA251_16360
    M013:
    M013TW_1760
    MRSA252:
    SAR1824
    MSHR1132:
    SAMSHR1132_15960
    MSSA476:
    SAS1672
    Mu3:
    SAHV_1732
    Mu50:
    SAV1746
    MW2:
    MW1689
    RF122:
    SAB1606
    ST398:
    SAPIG1799
    T0131:
    SAT0131_01854
    TCH60:
    HMPREF0772_11407
    TW20:
    SATW20_17360
    USA300_TCH1516:
    USA300HOU_1736
    VC40:
    SAVC_07940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKLKYIIPTIIAVAIVIISTISIIQFINRKRYNPVKVLNEVKSYFMNVKGSYIVYEPFV
    N315            MTKLKYIIPTIIAVAIVIISTISIIQFINRKRYNPVKVLNEVKSYFMNVKGSYIVYEPFV
    NCTC8325        MTKLKYIIPTIIAVAIVIISTISIIQFINRKRYNPVKVLNEVKSYFMNVKGSYIVYEPFV
    Newman          MTKLKYIIPTIIAVAIVIISTISIIQFINRKRYNPVKVLNEVKSYFMNVKGSYIVYEPFV
    USA300_FPR3757  MTKLKYIIPTIIAVAIVIISTISIIQFINRKRYNPVKVLNEVKSYFMNVKGSYIVYEPFV
                    ************************************************************

    COL             HPETDKYRLVYQGGITTIKNGQNIHYDFYADAYTGEVINIVER
    N315            HPETDKYRLVYQGGITTIKNGQNIHYDFYADAYTGEVINIVER
    NCTC8325        HPETDKYRLVYQGGITTIKNGQNIHYDFYADAYTGEVINIVER
    Newman          HPETDKYRLVYQGGITTIKNGQNIHYDFYADAYTGEVINIVER
    USA300_FPR3757  HPETDKYRLVYQGGITTIKNGQNIHYDFYADAYTGEVINIVER
                    *******************************************