From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004431000
  • symbol?:
  • description?: 16S pseudouridylate synthase

      descriptions from strain specific annotations:

    • 16S pseudouridylate synthase
    • pseudouridine synthase
    • pseudouridine synthase family 1 protein
    • 16S pseudouridine synthase A
    • pseudouridine synthase 1 protein
    • ribosomal small subunit pseudouridine synthase A
    • RNA pseudouridine synthase
    • pseudouridine synthase family protein
    • RNA pseudouridine synthase family protein
    • 16S RNA pseudouridylate synthase
    • pseudouridine synthase, family 1
  • strand?: -
  • coordinates?: 4678420..4679115
  • synteny block?: BlockID0034290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1711
    08BA02176:
    C248_1800
    11819-97:
    MS7_1759
    71193:
    ST398NM01_1806
    ECT-R 2:
    ECTR2_1593
    ED133:
    SAOV_1739
    ED98:
    SAAV_1763
    HO 5096 0412:
    SAEMRSA15_16610
    JH1:
    SaurJH1_1843
    JH9:
    SaurJH9_1808
    JKD6008:
    SAA6008_01725 (rsuA)
    JKD6159:
    SAA6159_01676 (rsuA)
    LGA251:
    SARLGA251_16430
    M013:
    M013TW_1768
    MRSA252:
    SAR1838
    MSHR1132:
    SAMSHR1132_16030
    MSSA476:
    SAS1679
    Mu3:
    SAHV_1739
    Mu50:
    SAV1753
    MW2:
    MW1696
    RF122:
    SAB1613c
    ST398:
    SAPIG1806
    T0131:
    SAT0131_01862
    TCH60:
    HMPREF0772_11399 (rsuA)
    TW20:
    SATW20_17430
    USA300_TCH1516:
    USA300HOU_1744 (rsuA)
    VC40:
    SAVC_07975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIEN
    N315            MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIEN
    NCTC8325        MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIEN
    Newman          MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIEN
    USA300_FPR3757  MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIEN
                    ************************************************************

    COL             VYIMLNKPKGYISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHE
    N315            VYIMLNKPKGYISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHE
    NCTC8325        VYIMLNKPKGYISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHE
    Newman          VYIMLNKPKGYISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHE
    USA300_FPR3757  VYIMLNKPKGYISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHE
                    ************************************************************

    COL             LMSPNKHVSKKYEVISANPITEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGK
    N315            LMSPNKHVSKKYEVISANPITEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGK
    NCTC8325        LMSPNKHVSKKYEVISANPITEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGK
    Newman          LMSPNKHVSKKYEVISANPITEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGK
    USA300_FPR3757  LMSPNKHVSKKYEVISANPITEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGK
                    ************************************************************

    COL             YHQVKRMFHSIQNEVLHLRRIKIADLELDSNLDSGEYRLLTENDFDKLNYK
    N315            YHQVKRMFHSIQNEVLHLRRIKIADLELDSNLDSGEYRLLTENDFDKLNYK
    NCTC8325        YHQVKRMFHSIQNEVLHLRRIKIADLELDSNLDSGEYRLLTENDFDKLNYK
    Newman          YHQVKRMFHSIQNEVLHLRRIKIADLELDSNLDSGEYRLLTENDFDKLNYK
    USA300_FPR3757  YHQVKRMFHSIQNEVLHLRRIKIADLELDSNLDSGEYRLLTENDFDKLNYK
                    ***************************************************