From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004432000
  • symbol?:
  • description?: spore cortex protein

      descriptions from strain specific annotations:

    • spore cortex protein
    • polysaccharide biosynthesis protein
    • putative polysaccharide biosynthesis protein
    • Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids
    • matE family protein
    • polysaccharide transporter
    • polysaccharide transport protein
    • export protein for polysaccharides and teichoic acids
  • strand?: -
  • coordinates?: 4679112..4680773
  • synteny block?: BlockID0034300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1712
    08BA02176:
    C248_1801
    11819-97:
    MS7_1760
    71193:
    ST398NM01_1807
    ECT-R 2:
    ECTR2_1594
    ED133:
    SAOV_1740
    ED98:
    SAAV_1764
    HO 5096 0412:
    SAEMRSA15_16620
    JH1:
    SaurJH1_1844
    JH9:
    SaurJH9_1809
    JKD6008:
    SAA6008_01726
    JKD6159:
    SAA6159_01677
    LGA251:
    SARLGA251_16440
    M013:
    M013TW_1769
    MRSA252:
    SAR1839
    MSHR1132:
    SAMSHR1132_16040
    MSSA476:
    SAS1680
    Mu3:
    SAHV_1740
    Mu50:
    SAV1754
    MW2:
    MW1697
    RF122:
    SAB1614c
    ST398:
    SAPIG1807
    T0131:
    SAT0131_01863
    TCH60:
    HMPREF0772_11398
    TW20:
    SATW20_17440
    USA300_TCH1516:
    USA300HOU_1745
    VC40:
    SAVC_07980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSESKEMVRGTFLITISILITKVLGVLFIIPFNYLIGGQENMAPFTYAYAPYNIAIAVAT
    N315            MSESKEMVRGTFLITISILITKVLGVLFIIPFNYLIGGQENMAPFTYAYAPYNIAIAVAT
    NCTC8325        MSESKEMVRGTFLITISILITKVLGVLFIIPFNYLIGGQENMAPFTYAYAPYNIAIAVAT
    Newman          MSESKEMVRGTFLITISILITKVLGVLFIIPFNYLIGGQENMAPFTYAYAPYNIAIAVAT
    USA300_FPR3757  MSESKEMVRGTFLITISILITKVLGVLFIIPFNYLIGGQENMAPFTYAYAPYNIAIAVAT
                    ************************************************************

    COL             AGVPLAASKYVAKYNAIGAYKVSQKFYKSSFIVMSITGVLGFLVLYFLAPYISELTLARN
    N315            AGVPLAASKYVAKYNAIGAYKVSQKFYKSSFIVMSITGVLGFLVLYFLAPYISELTLARN
    NCTC8325        AGVPLAASKYVAKYNAIGAYKVSQKFYKSSFIVMSITGVLGFLVLYFLAPYISELTLARN
    Newman          AGVPLAASKYVAKYNAIGAYKVSQKFYKSSFIVMSITGVLGFLVLYFLAPYISELTLARN
    USA300_FPR3757  AGVPLAASKYVAKYNAIGAYKVSQKFYKSSFIVMSITGVLGFLVLYFLAPYISELTLARN
                    ************************************************************

    COL             IHDKNGWSVDDITWIIRIISMVVIFIPVLATWRGIFQGYKSMGPTAVSEVTEQIARVIFI
    N315            IHDKNGWSVDDITWIIRIISMVVIFIPVLATWRGIFQGYKSMGPTAVSEVTEQIARVIFI
    NCTC8325        IHDKNGWSVDDITWIIRIISMVVIFIPVLATWRGIFQGYKSMGPTAVSEVTEQIARVIFI
    Newman          IHDKNGWSVDDITWIIRIISMVVIFIPVLATWRGIFQGYKSMGPTAVSEVTEQIARVIFI
    USA300_FPR3757  IHDKNGWSVDDITWIIRIISMVVIFIPVLATWRGIFQGYKSMGPTAVSEVTEQIARVIFI
                    ************************************************************

    COL             LIGSYLVLNVFDGSILLANGIATFAAAVGAIIGIFTLWYYWRKRKHNIDRMVESDYTDID
    N315            LIGSYLVLNVFDGSILLANGIATFAAAVGAIIGIFTLWYYWRKRKHNIDRMVESDYTDID
    NCTC8325        LIGSYLVLNVFDGSILLANGIATFAAAVGAIIGIFTLWYYWRKRKHNIDRMVESDYTDID
    Newman          LIGSYLVLNVFDGSILLANGIATFAAAVGAIIGIFTLWYYWRKRKHNIDRMVESDYTDID
    USA300_FPR3757  LIGSYLVLNVFDGSILLANGIATFAAAVGAIIGIFTLWYYWRKRKHNIDRMVESDYTDID
                    ************************************************************

    COL             VSYGKMYKEIIAYSIPFVIVSLNYPLFNLVDQFTHNGALSLVGIPSQLQDIFFNMLNMST
    N315            VSYGKMYKEIIAYSIPFVIVSLNYPLFNLVDQFTHNGALSLVGIPSQLQDIFFNMLNMST
    NCTC8325        VSYGKMYKEIIAYSIPFVIVSLNYPLFNLVDQFTHNGALSLVGIPSQLQDIFFNMLNMST
    Newman          VSYGKMYKEIIAYSIPFVIVSLNYPLFNLVDQFTHNGALSLVGIPSQLQDIFFNMLNMST
    USA300_FPR3757  VSYGKMYKEIIAYSIPFVIVSLNYPLFNLVDQFTHNGALSLVGIPSQLQDIFFNMLNMST
                    ************************************************************

    COL             NKIVMIPTSLSAGFAVSLIPYITKTFAEGRLHEMHHQIRTSIGVLMFITVPASIGIMALA
    N315            NKIVMIPTSLSAGFAVSLIPYITKTFAEGRLHEMHHQIRTSIGVLMFITVPASIGIMALA
    NCTC8325        NKIVMIPTSLSAGFAVSLIPYITKTFAEGRLHEMHHQIRTSIGVLMFITVPASIGIMALA
    Newman          NKIVMIPTSLSAGFAVSLIPYITKTFAEGRLHEMHHQIRTSIGVLMFITVPASIGIMALA
    USA300_FPR3757  NKIVMIPTSLSAGFAVSLIPYITKTFAEGRLHEMHHQIRTSIGVLMFITVPASIGIMALA
                    ************************************************************

    COL             QPLFTVFYGYDPIVLGHDPNHDGSRLLFYYAPVAILISLLSVTASMLQGIDKQKLTVYVI
    N315            QPLFTVFYGYDPIVLGHDPNHDGSRLLFYYAPVAILISLLSVTASMLQGIDKQKLTVYVI
    NCTC8325        QPLFTVFYGYDPIVLGHDPNHDGSRLLFYYAPVAILISLLSVTASMLQGIDKQKLTVYVI
    Newman          QPLFTVFYGYDPIVLGHDPNHDGSRLLFYYAPVAILISLLSVTASMLQGIDKQKLTVYVI
    USA300_FPR3757  QPLFTVFYGYDPIVLGHDPNHDGSRLLFYYAPVAILISLLSVTASMLQGIDKQKLTVYVI
                    ************************************************************

    COL             LASVVIKLALNYPLIMLFHTPGAILSTSIALLFAIGCNFYILKKYAKFKFSYSWIHFAKI
    N315            LASVVIKLALNYPLIMLFHTPGAILSTSIALLFAIGCNFYILKKYAKFKFSYSWIHFAKI
    NCTC8325        LASVVIKLALNYPLIMLFHTPGAILSTSIALLFAIGCNFYILKKYAKFKFSYSWIHFAKI
    Newman          LASVVIKLALNYPLIMLFHTPGAILSTSIALLFAIGCNFYILKKYAKFKFSYSWIHFAKI
    USA300_FPR3757  LASVVIKLALNYPLIMLFHTPGAILSTSIALLFAIGCNFYILKKYAKFKFSYSWIHFAKI
                    ************************************************************

    COL             FLYSFIMMLGVELVFFLANLFLEPTKLGYLIIIILGVTVGILIYGTITIKTRLADEFLGE
    N315            FLYSFIMMLGVELVFFLANLFLEPTKLGYLIIIILGVTVGILIYGTITIKTRLADEFLGE
    NCTC8325        FLYSFIMMLGVELVFFLANLFLEPTKLGYLIIIILGVTVGILIYGTITIKTRLADEFLGE
    Newman          FLYSFIMMLGVELVFFLANLFLEPTKLGYLIIIILGVTVGILIYGTITIKTRLADEFLGE
    USA300_FPR3757  FLYSFIMMLGVELVFFLANLFLEPTKLGYLIIIILGVTVGILIYGTITIKTRLADEFLGE
                    ************************************************************

    COL             IPEKLRRRVRFLR
    N315            IPEKLRRRVRFLR
    NCTC8325        IPEKLRRRVRFLR
    Newman          IPEKLRRRVRFLR
    USA300_FPR3757  IPEKLRRRVRFLR
                    *************