From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004433000
  • symbol?:
  • description?: NAD(FAD)-utilizing dehydrogenase

      descriptions from strain specific annotations:

    • NAD(FAD)-utilizing dehydrogenase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • putative flavoprotein
    • exported protein
  • strand?: +
  • coordinates?: 4681170..4682261
  • synteny block?: BlockID0034310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1713
    08BA02176:
    C248_1802
    11819-97:
    MS7_1761
    71193:
    ST398NM01_1808
    ECT-R 2:
    ECTR2_1595
    ED133:
    SAOV_1741
    ED98:
    SAAV_1765
    HO 5096 0412:
    SAEMRSA15_16630
    JH1:
    SaurJH1_1845
    JH9:
    SaurJH9_1810
    JKD6008:
    SAA6008_01727
    JKD6159:
    SAA6159_01678
    LGA251:
    SARLGA251_16450
    M013:
    M013TW_1771
    MRSA252:
    SAR1840
    MSHR1132:
    SAMSHR1132_16050
    MSSA476:
    SAS1681
    Mu3:
    SAHV_1741
    Mu50:
    SAV1755
    MW2:
    MW1698
    RF122:
    SAB1615
    ST398:
    SAPIG1808
    T0131:
    SAT0131_01864
    TCH60:
    HMPREF0772_11397
    TW20:
    SATW20_17450
    USA300_TCH1516:
    USA300HOU_1746
    VC40:
    SAVC_07985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEII
    N315            MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEII
    NCTC8325        MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEII
    Newman          MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEII
    USA300_FPR3757  MYQTIIIGGGPSGLMAAVAASEQSSSVLLIEKKKGLGRKLKISGGGRCNVTNRLPYAEII
                    ************************************************************

    COL             KNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIE
    N315            KNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIE
    NCTC8325        KNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIE
    Newman          KNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIE
    USA300_FPR3757  KNIPGNGKFLYSPFSIFDNESIIDFFESRGVKLKEEDHGRMFPVSNKAQDVVDTLVTTIE
                    ************************************************************

    COL             RQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQ
    N315            RQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQ
    NCTC8325        RQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQ
    Newman          RQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQ
    USA300_FPR3757  RQHVTIKEEEAVSRIEVNTDQTFTVHTQNNSYESHSLVIATGGTSVPQTGSTGDGYKFAQ
                    ************************************************************

    COL             DLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHF
    N315            DLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHF
    NCTC8325        DLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHF
    Newman          DLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKRISHQMDMLFTHF
    USA300_FPR3757  DLGHTITELFPTEVPITSAEPFIKSNRLKGLSLKDVELSVLKKNGKKHISHQMDMLFTHF
                    ***********************************************:************

    COL             GISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNS
    N315            GISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNS
    NCTC8325        GISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNS
    Newman          GISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNS
    USA300_FPR3757  GISGPAALRCSQFVYKEQKNQKTQHISMAIDAFPELNHEQLKQHITSLLSDTPDKIIKNS
                    ************************************************************

    COL             LHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTG
    N315            LHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTG
    NCTC8325        LHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTG
    Newman          LHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTG
    USA300_FPR3757  LHGLIEERYLLFMLEQAGIDENTTSHHLSNQQLNDLVNMFKGFVFKVNGTLPIDKAFVTG
                    ************************************************************

    COL             GGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHAS
    N315            GGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHTS
    NCTC8325        GGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHAS
    Newman          GGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHAS
    USA300_FPR3757  GGVSLKEIQPKTMMSKLVPGLFLCGEVLDIHGYTGGYNITSALVTGHVAGLYAGHYSHAS
                    **********************************************************:*

    COL             ME
    N315            ME
    NCTC8325        ME
    Newman          ME
    USA300_FPR3757  ME
                    **