From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004438000
  • symbol?: sasC
  • description?: Mrp protein

      descriptions from strain specific annotations:

    • Mrp protein
    • cell wall surface anchor family protein
    • cell wall anchor domain-containing protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • cell-wall-anchored protein SasC (LPXTG motif)
    • cell surface anchored protein
    • LPXTG surface protein
    • lpxtg-motif cell wall anchor domain
    • extracellular matrix binding protein
    • putative surface anchored protein
  • strand?: -
  • coordinates?: 4682669..4689256
  • synteny block?: BlockID0034360
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1714 (sasC)
    08BA02176:
    C248_1803 (sasC)
    11819-97:
    MS7_1762
    71193:
    ST398NM01_1809
    ECT-R 2:
    ECTR2_1596
    ED133:
    ED98:
    SAAV_1766
    HO 5096 0412:
    SAEMRSA15_16640 (sasC)
    JH1:
    SaurJH1_1846
    JH9:
    SaurJH9_1811
    JKD6008:
    SAA6008_01728 (sasC)
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1841 (sasC)
    MSHR1132:
    MSSA476:
    SAS1682
    Mu3:
    SAHV_1744 (mrp)
    Mu50:
    SAV1758 (mrp)
    MW2:
    MW1699
    RF122:
    ST398:
    SAPIG1809
    T0131:
    SAT0131_01865
    TCH60:
    HMPREF0772_11395 (sasC)
    TW20:
    SATW20_17460 (sasC)
    USA300_TCH1516:
    USA300HOU_1747 (fmtB1)
    VC40:
    SAVC_07990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLLKKNKYSIRKYKVGIFSTLIGTVLLLSNPNGAQALTTDNNVQSDTNQATPVNSQDKD
    N315            MNLLKKNKYSIRKYKVGIFSTLIGTVLLLSNPNGAQALTTDNNVQSDTNQATPVNSQDTN
    NCTC8325        MNLLKKNKYSIRKYKVGIFSTLIGTVLLLSNPNGAQALTTDNNVQSDTNQATPVNSQDKD
    Newman          MNLLKKNKYSIRKYKVGIFSTLIGTVLLLSNPNGAQALTTDNNVQSDTNQATPVNSQDKD
    USA300_FPR3757  MNLLKKNKYSIRKYKVGIFSTLIGTVLLLSNPNGAQALTTDNNVQSDTNQATPVNSQDKD
                    **********************************************************.:

    COL             VANNRGLANSAQNTPNQSATTNQATNQALVNHNNGSIVNQATPTSVQSSTPSAQNNNHTD
    N315            VANNRGLANSAQNTPNQSATTNQSTNQALVNHNNGSIANQATPTSVQSSTPSAQNNNHTD
    NCTC8325        VANNRGLANSAQNTPNQSATTNQATNQALVNHNNGSIVNQATPTSVQSSTPSAQNNNHTD
    Newman          VANNRGLANSAQNTPNQSATTNQATNQALVNHNNGSIVNQATPTSVQSSTPSAQNNNHTD
    USA300_FPR3757  VANNRGLANSAQNTPNQSATTNQATNQALVNHNNGSIVNQATPTSVQSSTPSAQNNNHTD
                    ***********************:*************.**********************

    COL             GNTTATETVSNANNNDVVSNNTALNVPTKTNENGSGGHLTLKEIQEDVRHSSNKPELVAI
    N315            GNTTATETVSNANNKDVVSNNTTLNVPNKTNENGSGGHLTLKEIQEDVRHSSDKPELVAI
    NCTC8325        GNTTATETVSNANNNDVVSNNTALNVPTKTNENGSGGHLTLKEIQEDVRHSSNKPELVAI
    Newman          GNTTATETVSNANNNDVVSNNTALNVPTKTNENGSGGHLTLKEIQEDVRHSSNKPELVAI
    USA300_FPR3757  GNTTATETVSNANNNDVVSNNTALNVPTKTNENGSGGHLTLKEIQEDVRHSSNKPELVAI
                    **************:*******:****.************************:*******

    COL             AEPASNRPKKRSRRAAPADPNATPADPAAAAVGNGGEPVAITAPYTPTTDPNANNAGQNA
    N315            AEQASNRPKKRSRRAAPADPNATPADPAAAAAGNGGAPVAITAPYTPTTDPNANNAGQNA
    NCTC8325        AEPASNRPKKRSRRAAPADPNATPADPAAAAVGNGGAPVAITAPYTPTTDPNANNAGQNA
    Newman          AEPASNRPKKRSRRAAPADPNATPADPAAAAVGNGGAPVAITAPYTPTTDPNANNAGQNA
    USA300_FPR3757  AEPASNRPKKRSRRAAPADPNATPADPAAAAVGNGGAPVAITAPYTPTTDPNANNAGQNA
                    ** ****************************.**** ***********************

    COL             PNEVLSFDDNGIRPSTNRSVPTVNVVNNLPGFTLINGGKVGVFSHAMVRTSMFDSGDNKN
    N315            PNEVLSFDDNGIRPSTNRSVPSVTVVDNLPGFTLINGGKVGVFSHAMVRTSMFDSGDAKN
    NCTC8325        PNEVLSFDDNGIRPSTNRSVPTVNVVNNLPGFTLINGGKVGVFSHAMVRTSMFDSGDNKN
    Newman          PNEVLSFDDNGIRPSTNRSVPTVNVVNNLPGFTLINGGKVGVFSHAMVRTSMFDSGDNKN
    USA300_FPR3757  PNEVLSFDDNGIRPSTNRSVPTVNVVNNLPGFTLINGGKVGVFSHAMVRTSMFDSGDNKN
                    *********************:*.**:****************************** **

    COL             YQAQGNVIALGRIHGTDTNDHGDFNGIEKALTVNPNSELIFEFNTMTTKNGQGATNVIIK
    N315            YQAQGNVIALGRIKGNDTNDHGDFNGIEKSLTVNPNSELIFEFNTMTTKNYQGVTNLIIK
    NCTC8325        YQAQGNVIALGRIHGTDTNDHGDFNGIEKALTVNPNSELIFEFNTMTTKNGQGATNVIIK
    Newman          YQAQGNVIALGRIHGTDTNDHGDFNGIEKALTVNPNSELIFEFNTMTTKNGQGATNVIIK
    USA300_FPR3757  YQAQGNVIALGRIHGTDTNDHGDFNGIEKALTVNPNSELIFEFNTMTTKNGQGATNVIIK
                    *************:*.*************:******************** **.**:***

    COL             NADTNDTIAEKTVEGGPTLRLFKVPDNVRNLKIQFVPKNDAITDARGIYQLKDGYKYYSF
    N315            NADNDTVIAEKSVAYGPIWRLFKVPENVSHLKIQFVPKNDAITDARGIYQLRDGYKYYDF
    NCTC8325        NADTNDTIAEKTVEGGPTLRLFKVPDNVRNLKIQFVPKNDAITDARGIYQLKDGYKYYSF
    Newman          NADTNDTIAEKTVEGGPTLRLFKVPDNVRNLKIQFVPKNDAITDARGIYQLKDGYKYYSF
    USA300_FPR3757  NADTNDTIAEKTVEGGPTLRLFKVPDNVRNLKIQFVPKNDAITDARGIYQLKDGYKYYSF
                    ***.: .****:*  **  ******:** :*********************:******.*

    COL             VDSIGLHSGSHVFVERRTMDPTATNNKEFTVTTSLKNNGNSGASLDTNDFVYQVQLPEGV
    N315            VDSIGLHSGSHVYVERRTMEPTATNNKEFTVTTSLKNNGNFGASFNTDDFVYKVQLPEGV
    NCTC8325        VDSIGLHSGSHVFVERRTMDPTATNNKEFTVTTSLKNNGNSGASLDTNDFVYQVQLPEGV
    Newman          VDSIGLHSGSHVFVERRTMDPTATNNKEFTVTTSLKNNGNSGASLDTNDFVYQVQLPEGV
    USA300_FPR3757  VDSIGLHSGSHVFVERRTMDPTATNNKEFTVTTSLKNNGNSGASLDTNDFVYQVQLPEGV
                    ************:******:******************** ***::*:****:*******

    COL             EYVNNSLTKDFPSNNSGVDVNDMNVTYDAANRVITIKSTGGGTANSPARLMPDKILDLRY
    N315            EYVNNSLTKDFPSSNSGVDMNDFNVTYDAANRVITIKSTGGGSGNSPARLMPDKILDLKY
    NCTC8325        EYVNNSLTKDFPSNNSGVDVNDMNVTYDAANRVITIKSTGGGTANSPARLMPDKILDLRY
    Newman          EYVNNSLTKDFPSNNSGVDVNDMNVTYDAANRVITIKSTGGGTANSPARLMPDKILDLRY
    USA300_FPR3757  EYVNNSLTKDFPSNNSGVDVNDMNVTYDAANRVITIKSTGGGTANSPARLMPDKILDLRY
                    *************.*****:**:*******************:.**************:*

    COL             KLRVNNVPTPRTVTFNETLTYKTYTQDFINSAAESHTVSTNPYTIDIIMNKDALQAEVDR
    N315            KLRVNNVPTPRTVTFNDTLTYKTYTQDFINSPAESHTVSTNPYTIDIIMNKDALQAEVDR
    NCTC8325        KLRVNNVPTPRTVTFNETLTYKTYTQDFINSAAESHTVSTNPYTIDIIMNKDALQAEVDR
    Newman          KLRVNNVPTPRTVTFNETLTYKTYTQDFINSAAESHTVSTNPYTIDIIMNKDALQAEVDR
    USA300_FPR3757  KLRVNNVPTPRTVTFNETLTYKTYTQDFINSAAESHTVSTNPYTIDIIMNKDALQAEVDR
                    ****************:**************.****************************

    COL             RIQQADYTFASLDIFNGLKRRAQTILDENRNNVPLNKRVSQAYIDSLTNQMQHTLIRSVD
    N315            RIQQADYTFASLDIFNDLKRRAQTILDENRNNVPLNKRVSQADIDSLTNQMQHTLIRSVD
    NCTC8325        RIQQADYTFASLDIFNGLKRRAQTILDENRNNVPLNKRVSQAYIDSLTNQMQHTLIRSVD
    Newman          RIQQADYTFASLDIFNGLKRRAQTILDENRNNVPLNKRVSQAYIDSLTNQMQHTLIRSVD
    USA300_FPR3757  RIQQADYTFASLDIFNGLKRRAQTILDENRNNVPLNKRVSQAYIDSLTNQMQHTLIRSVD
                    ****************.************************* *****************

    COL             AENAVNKKVDQMEDLVNQNDELTDEEKQAAIQVIEEHKNEIIGNIGDQTTDDGVTRIKDQ
    N315            AENAVNKKVDQMEDLVNQNDELTDEEKQAAIQVIEEHKNEIIGNIGDQTTDDGVTRIKDQ
    NCTC8325        AENAVNKKVDQMEDLVNQNDELTDEEKQAAIQVIEEHKNEIIGNIGDQTTDDGVTRIKDQ
    Newman          AENAVNKKVDQMEDLVNQNDELTDEEKQAAIQVIEEHKNEIIGNIGDQTTDDGVTRIKDQ
    USA300_FPR3757  AENAVNKKVDQMEDLVNQNDELTDEEKQAAIQVIEEHKNEIIGNIGDQTTDDGVTRIKDQ
                    ************************************************************

    COL             GIQTLSGDTATPVVKPNAKKAIRDKATKQREIINATPDVTEDEIQDALNQLATDETDAID
    N315            GIQTLSGDTATPVVKPNAKKAIRDKATKQREIINATPDATEDEIQDALNQLATDETDAID
    NCTC8325        GIQTLSGDTATPVVKPNAKKAIRDKATKQREIINATPDATEDEIQDALNQLATDETDAID
    Newman          GIQTLSGDTATPVVKPNAKKAIRDKATKQREIINATPDVTEDEIQDALNQLATDETDAID
    USA300_FPR3757  GIQTLSGDTATPVVKPNAKKAIRDKATKQREIINATPDVTEDEIQDALNQLATDETDAID
                    **************************************.*********************

    COL             NVTNATTNADVETAKNNGINTIGAVVPQVTHKKAARDAINQATATKRQQINSNREATQEE
    N315            NVTNATTNADVEIAKNNGINTIGAVVPQVTHKQAARDAINQATATKRQQINSNREATQEE
    NCTC8325        NVTNATTNADVETAKNNGINTIGAVVPQVTHKKAARDAINQATATKRQQINSNREATQEE
    Newman          NVTNATTNADVETAKNNGINTIGAVVPQVTHKKAARDAINQATATKRQQINSNREATQEE
    USA300_FPR3757  NVTNATTNADVETAKNNGINTIGAVVPQVTHKKAARDAINQATATKRQQINSNREATQEE
                    ************ *******************:***************************

    COL             KNAALNELTQATNHALEQINQATTNADVDNAKGDGLNAINPIAPVTVVKQAARDAVSHDA
    N315            KNAALNELTQATNHALEQINQATTNADVDNAKGDGLNAINPIAPVTVVKQAARDAVSHDA
    NCTC8325        KNAALNELTQATNHALEQINQATTNANVDNAKGDGLNAINPIAPVTVVKQAARDAVSHDA
    Newman          KNAALNELTQATNHALEQINQATTNADVDNAKGDGLNAINPIAPVTVVKQAARDAVSHDA
    USA300_FPR3757  KNAALNELTQATNHALEQINQATTNADVDNAKGDGLNAINPIAPVTVVKQAARDAVSHDA
                    **************************:*********************************

    COL             QQHIAEINANPDATQEERQAAIDKVNAAVTAANTNILNANTNADVEQVKTNAIQGIQAIT
    N315            QQHIAEINANPDATQEERQAAIDKVNAAVTAANTNILNANTNADVEQVKTNAIQGIQAIT
    NCTC8325        QQHIAEINANPDATQEERQAAIDKVNAAVTAANTNILNANTNADVEQVKTNAIQGIQAIT
    Newman          QQHIAEINANPDATQEERQAAIDKVNAAVTAANTNILNANTNADVEQVKTNAIQGIQAIT
    USA300_FPR3757  QQHIAEINANPDATQEERQAAIDKVNAAVTAANTNILNANTNADVEQVKTNAIQGIQAIT
                    ************************************************************

    COL             PATKVKTDAKNAIDKSAETQHNTIFNNNDATLEEQQAAQQLLDQAVATAKQNINAADTNQ
    N315            PATKVKTDAKNAIDKSAETQHNTIFNNNDATLEEQQAAQQLLDQAVATAKQNINAADTNQ
    NCTC8325        PATKVKTDAKNAIDKSAETQHNTIFNNNDATLEEQQAAQQLLDQAVATAKQNINAADTNQ
    Newman          PATKVKTDAKNAIDKSAETQHNTIFNNNDATLEEQQAAQQLLDQAVATAKQNINAADTNQ
    USA300_FPR3757  PATKVKTDAKNAIDKSAETQHNTIFNNNDATLEEQQAAQQLLDQAVATAKQNINAADTNQ
                    ************************************************************

    COL             EVAQAKDQGTQNIVVIQPATQVKTDTRNVVNDKAREAITNINATTGATREEKQEAINRVN
    N315            EVAQAKDQGTQNIVVIQPATQVKTDARNAVNDKAREAITNINATPGATREEKQEAINRVN
    NCTC8325        EVAQAKDQGTQNIVVIQPATQVKTDTRNVVNDKAREAITNINATTGATREEKQEAINRVN
    Newman          EVAQAKDQGTQNIVVIQPATQVKTDTRNVVNDKAREAITNINATTGATREEKQEAINRVN
    USA300_FPR3757  EVAQAKDQGTQNIVVIQPATQVKTDTRNVVNDKAREAITNINATTGATREEKQEAINRVN
                    *************************:**.***************.***************

    COL             TLKNRALTDIGVTSTTAMVNSIRDDAVNQIGAVQPHVTKKQTATGVLNDLATAKKQEINQ
    N315            TLKNRALTDIGVTSTTAMVNSIRDDAVNQIGAVQPHVTKKQTATGVLNDLATAKKQEINQ
    NCTC8325        TLKNRALTDIGVTSTTAMVNSIRDDAVNQIGAVQPHVTKKQTATGVLNDLATAKKQEINQ
    Newman          TLKNRALTDIGVTSTTAMVNSIRDDAVNQIGAVQPHVTKKQTATGVLNDLATAKKQEINQ
    USA300_FPR3757  TLKNRALTDIGVTSTTAMVNSIRDDAVNQIGAVQPHVTKKQTATGVLNDLATAKKQEINQ
                    ************************************************************

    COL             NTNATTEEKQVALNQVDQELATAINNINQADTNAEVDQAQQLGTKAINAIQPNIVKKPAA
    N315            NTNATTEEKQVALNQVDQELATAINNINQADTNAEVDQAQQLGTKAINAIQPNIVKKPAA
    NCTC8325        NTNATTEEKQVALNQVDQELATAINNINQADTNAEVDQAQQLGTKAINAIQPNIVKKPAA
    Newman          NTNATTEEKQVALNQVDQELATAINNINQADTNAEVDQAQQLGTKAINAIQPNIVKKPAA
    USA300_FPR3757  NTNATTEEKQVALNQVDQELATAINNINQADTNAEVDQAQQLGTKAINAIQPNIVKKPAA
                    ************************************************************

    COL             LAQINQHYNAKLAEINATPDATNDEKNAAINTLNQDRQQAIESIKQANTNAEVDQAATVA
    N315            LAQINQHYNAKLAEINATPDATNDEKNAAINTLNQDRQQAIESIKQANTNAEVDQAATVA
    NCTC8325        LAQINQHYNAKLAEINATPDATNDEKNAAINTLNQDRQQAIESIKQANTNAEVDQAATVA
    Newman          LAQINQHYNAKLAEINATPDATNDEKNAAINTLNQDRQQAIESIKQANTNAEVDQAATVA
    USA300_FPR3757  LAQINQHYNAKLAEINATPDATNDEKNAAINTLNQDRQQAIESIKQANTNAEVDQAATVA
                    ************************************************************

    COL             ENNIDAVQVDVVKKQAARDKITAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQ
    N315            ENNIDAVQVDVVKKQAARDKITAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQ
    NCTC8325        ENNIDAVQVDVVKKQAARDKITAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQ
    Newman          ENNIDAVQVDVVKKQAARDKITAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQ
    USA300_FPR3757  ENNIDAVQVDVVKKQAARDKITAEVAKRIEAVKQTPNATDEEKQAAVNQINQLKDQAINQ
                    ************************************************************

    COL             INQNQTNDQVDTTTNQAVNAIDNVEAEVVIKPKAIADIEKAVKEKQQQIDNSLDSTDNEK
    N315            INQNQTNDQVDTTTNQAVNAIDNVEAEVVIKPKAIADIEKAVKEKQQQIDNSLDSTDNEK
    NCTC8325        INQNQTNDQVDTTTNQAVNAIDNVEAEVVIKTKAIADIEKAVKEKQQQIDNSLDSTDNEK
    Newman          INQNQTNDQVDTTTNQAVNAIDNVEAEVVIKPKAIADIEKAVKEKQQQIDNSLDSTDNEK
    USA300_FPR3757  INQNQTNDQVDTTTNQAVNAIDNVEAEVVIKPKAIADIEKAVKEKQQQIDNSLDSTDNEK
                    *******************************.****************************

    COL             EVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKAN
    N315            EVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKAN
    NCTC8325        EVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKAN
    Newman          EVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKAN
    USA300_FPR3757  EVASQALAKEKEKALAAIDQAQTNSQVNQAATNGVSAIKIIQPETKVKPAAREKINQKAN
                    ************************************************************

    COL             ELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVTP
    N315            ELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVAP
    NCTC8325        ELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVTP
    Newman          ELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVTP
    USA300_FPR3757  ELRAKINQDKEATAEERQVALDKINEFVNQAMTDITNNRTNQQVDDTTSQALDSIALVTP
                    **********************************************************:*

    COL             DHIVRAAARDAVKQQYEAKKREIEQAEHATDEEKQVALNQLANNEKRALQNIDQAIANND
    N315            EHIVRAAARDAVKQQYEAKKQEIEQAEHATDEEKQVALNQLANNEKLALQNINQAVTNND
    NCTC8325        DHIVRAAARDAVKQQYEAKKREIEQAEHATDEEKQVALNQLANNEKRALQNIDQAIANND
    Newman          DHIVRAAARDAVKQQYEAKKREIEQAEHATDEEKQVALNQLANNEKRALQNIDQAIANND
    USA300_FPR3757  DHIVRAAARDAVKQQYEAKKREIEQAEHATDEEKQVALNQLANNEKRALQNIDQAIANND
                    :*******************:************************* *****:**::***

    COL             VKRVETNGIATLKGVQPHIVIKPEAQQAIKASAENQVESIKDTPHATVDELDEANQLISD
    N315            VKRVETNGIATLKGVQPHIVIKPEAQQAIKATAENQVESIKDTPHATVDELDEANQLISD
    NCTC8325        VKRVETNGIATLKGVQPHIVIKPEAQQAIKASAENQVESIKDTPHATVDELDEANQLISD
    Newman          VKRVETNGIATLKGVQPHIVIKPEAQQAIKASAENQVESIKDTPHATVDELDEANQLISD
    USA300_FPR3757  VKRVETNGIATLKGVQPHIVIKPEAQQAIKASAENQVESIKDTPHATVDELDEANQLISD
                    *******************************:****************************

    COL             TLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNT
    N315            TLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNT
    NCTC8325        TLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNT
    Newman          TLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNT
    USA300_FPR3757  TLKQAQQEIENTNQDAAVTDVRNQTIKAIEQIKPKVRRKRAALDSIEENNKNQLDAIRNT
                    ************************************************************

    COL             LDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAAR
    N315            LDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAAR
    NCTC8325        LDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAAR
    Newman          LDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAAR
    USA300_FPR3757  LDTTQDERDVAIDTLNKIVNTIKNDIAQNKTNAEVDRTETDGNDNIKVILPKVQVKPAAR
                    ************************************************************

    COL             QSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSINAQ
    N315            QSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSIDAQ
    NCTC8325        QSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSINAQ
    Newman          QSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSINAQ
    USA300_FPR3757  QSVGVKAEAQNALIDQSDLSTEEERLAAKHLVEQALNQAIDQINHADKTAQVNQDSINAQ
                    *********************************************************:**

    COL             NIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQI
    N315            NIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQI
    NCTC8325        NIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQI
    Newman          NIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQI
    USA300_FPR3757  NIISKIKPATTVKATALQQIQNIATNKINLIKANNEATDEEQNIAIAQVEKELIKAKQQI
                    ************************************************************

    COL             ASAVTNADVAYLLHDEKNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERN
    N315            ASAVTNADVAYLLHDEKNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERN
    NCTC8325        ASAVTNADVAYLLHDEKNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERN
    Newman          ASAVTNADVAYLLHDEKNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERN
    USA300_FPR3757  ASAVTNADVAYLLHDEKNEIREIEPVINRKASAREQLTTLFNDKKQAIEANIQATVEERN
                    ************************************************************

    COL             SILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLAR
    N315            SILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLAR
    NCTC8325        SILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLAR
    Newman          SILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLAR
    USA300_FPR3757  SILAQLQNIYDTAIGQIDQDRSNAQVDKTASLNLQTIHDLDVHPIKKPDAEKTINDDLAR
                    ************************************************************

    COL             VTALVQNYRKVSNRNKADALKAITALKLQMDEELKTARTNADVDAVLKRFNVALSDIEAV
    N315            VTALVQNYRKVSNRNKADALKAITALKLQMDEELKTARTNADVDAVLKRFNVALSDIEAV
    NCTC8325        VTALVQNYRKVSNRNKADALKAITALKLQMDEELKTARTNADVDAVLKRFNVALSDIEAV
    Newman          VTALVQNYRKVSNRNKADALKAITALKLQMDEELKTARTNADVDAVLKRFNVALSDIEAV
    USA300_FPR3757  VTALVQNYRKVSNRNKADALKAITALKLQMDEELKTARTNADVDAVLKRFNVALSDIEAV
                    ************************************************************

    COL             ITEKENSLLRIDNIAQQTYAKFKAIATPEQLAKVKVLIDQYVADGNRMIDEDATLNDIKQ
    N315            ITEKENSLLRIDNIAQQTYAKFKAIATPEQLAKVKVLIDQYVADGNRMIDEDATLNDIKQ
    NCTC8325        ITEKENSLLRIDNIAQQTYAKFKAIATPEQLAKVKVLIDQYVADGNRMIDEDATLNDIKQ
    Newman          ITEKENSLLRIDNIAQQTYAKFKAIATPEQLAKVKVLIDQYVADGNRMIDEDATLNDIKQ
    USA300_FPR3757  ITEKENSLLRIDNIAQQTYAKFKAIATPEQLAKVKVLIDQYVADGNRMIDEDATLNDIKQ
                    ************************************************************

    COL             HTQFIVDEILAIKLPAEATKVSPKEIQPAPKVCTPIKKEETHESRKVEKELPNTGSEGMD
    N315            HTQFIVDEILAIKLPAEATKVSPKEIQPAPKVCTPIKKEETHESRKVEKELPNTGSEGMD
    NCTC8325        HTQFIVDEILAIKLPAEATKVSPKEIQPAPKVCTPIKKEETHESRKVEKELPNTGSEGMD
    Newman          HTQFIVDEILAIKLPAEATKVSPKEIQPAPKVCTPIKKEETHESRKVEKELPNTGSEGMD
    USA300_FPR3757  HTQFIVDEILAIKLPAEATKVSPKEIQPAPKVCTPIKKEETHESRKVEKELPNTGSEGMD
                    ************************************************************

    COL             LPLKEFALITGAALLARRRTKNEKES
    N315            LPLKEFALITGAALLARRRTKNEKES
    NCTC8325        LPLKEFALITGAALLARRRTKNEKES
    Newman          LPLKEFALITGAALLARRRTKNEKES
    USA300_FPR3757  LPLKEFALITGAALLARRRTKNEKES
                    **************************