From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004452000
  • symbol?:
  • description?: lysophospholipase-like protein

      descriptions from strain specific annotations:

    • lysophospholipase-like protein
    • alpha/beta hydrolase
    • lysophospholipase, putative
    • Lysophospholipase
    • Monoglyceride lipase
    • putative
    • putative lysophospholipase
    • Alpha/beta hydrolase fold protein
    • alpha/beta hydrolase fold family protein
    • hydrolase, alpha/beta fold family, putative
    • Lysophospholipase L2
    • Lysophospholipase, Monoglyceridelipase, putative
  • strand?: -
  • coordinates?: 4700423..4701250
  • synteny block?: BlockID0034490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1721
    08BA02176:
    C248_1810
    11819-97:
    MS7_1769
    71193:
    ST398NM01_1816
    ECT-R 2:
    ECTR2_1603
    ED133:
    SAOV_1749
    ED98:
    SAAV_1774
    HO 5096 0412:
    SAEMRSA15_16720
    JH1:
    SaurJH1_1853
    JH9:
    SaurJH9_1818
    JKD6008:
    SAA6008_01737 (pldB)
    JKD6159:
    SAA6159_01686 (pldB)
    LGA251:
    SARLGA251_16530
    M013:
    M013TW_1779
    MRSA252:
    SAR1848
    MSHR1132:
    SAMSHR1132_16130
    MSSA476:
    SAS1689
    Mu3:
    SAHV_1751
    Mu50:
    SAV1765
    MW2:
    MW1706
    RF122:
    SAB1623c
    ST398:
    SAPIG1816
    T0131:
    SAT0131_01878
    TCH60:
    HMPREF0772_11388
    TW20:
    SATW20_17560
    USA300_TCH1516:
    USA300HOU_1755
    VC40:
    SAVC_08035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQI
    N315            MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQI
    NCTC8325        MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQI
    Newman          MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQI
    USA300_FPR3757  MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQI
                    ************************************************************

    COL             ENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQ
    N315            ENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQ
    NCTC8325        ENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQ
    Newman          ENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQ
    USA300_FPR3757  ENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQ
                    ************************************************************

    COL             KNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTI
    N315            KNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTI
    NCTC8325        KNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTI
    Newman          KNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTI
    USA300_FPR3757  KNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTI
                    ************************************************************

    COL             NETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVH
    N315            NETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVH
    NCTC8325        NETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVH
    Newman          NETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVH
    USA300_FPR3757  NETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVH
                    ************************************************************

    COL             NEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI
    N315            NEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI
    NCTC8325        NEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI
    Newman          NEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI
    USA300_FPR3757  NEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI
                    ***********************************