From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004454000
  • symbol?: putA
  • description?: proline dehydrogenase

      descriptions from strain specific annotations:

    • proline dehydrogenase
    • proline dehydrohenase-like protein
    • Proline dehydrogenase (Proline oxidase)
    • proline dehydrogenase family protein
    • proline dehydrogenase 1
    • proline oxidase
  • strand?: +
  • coordinates?: 4701484..4702485
  • synteny block?: BlockID0034510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1816 (putA)
    N315:
    NCTC8325:
    Newman:
    NWMN_1658 (putA)
    USA300_FPR3757:
    04-02981:
    SA2981_1722
    08BA02176:
    C248_1812
    11819-97:
    MS7_1770 (fadM)
    71193:
    ST398NM01_1818
    ECT-R 2:
    ECTR2_1604
    ED133:
    SAOV_1750
    ED98:
    SAAV_1776 (putA)
    HO 5096 0412:
    SAEMRSA15_16730
    JH1:
    SaurJH1_1854
    JH9:
    SaurJH9_1819
    JKD6008:
    SAA6008_01739 (putA)
    JKD6159:
    SAA6159_01687 (putA)
    LGA251:
    SARLGA251_16540
    M013:
    M013TW_1780
    MRSA252:
    SAR1849
    MSHR1132:
    SAMSHR1132_16140
    MSSA476:
    SAS1690
    Mu3:
    SAHV_1752
    Mu50:
    SAV1766
    MW2:
    MW1707
    RF122:
    SAB1624
    ST398:
    SAPIG1818
    T0131:
    SAT0131_01880
    TCH60:
    HMPREF0772_11387 (putA)
    TW20:
    SATW20_17570
    USA300_TCH1516:
    USA300HOU_1756 (putA)
    VC40:
    SAVC_08040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
    N315            MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
    NCTC8325        MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
    Newman          MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
    USA300_FPR3757  MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
                    ************************************************************

    COL             LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
    N315            LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
    NCTC8325        LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
    Newman          LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
    USA300_FPR3757  LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
                    ************************************************************

    COL             ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHELVDKYQDLRLR
    N315            ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHKLVDKYQDLRLR
    NCTC8325        ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHELVDKYQDLRLR
    Newman          ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHELVDKYQDLRLR
    USA300_FPR3757  ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHELVDKYQDLRLR
                    ************************************************:***********

    COL             LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
    N315            LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
    NCTC8325        LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
    Newman          LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
    USA300_FPR3757  LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
                    ************************************************************

    COL             IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
    N315            IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
    NCTC8325        IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
    Newman          IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
    USA300_FPR3757  IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
                    ************************************************************

    COL             FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
    N315            FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
    NCTC8325        FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
    Newman          FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
    USA300_FPR3757  FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
                    *********************************