From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004458000
  • symbol?: ribD
  • description?: riboflavin biosynthesis protein RibD

      descriptions from strain specific annotations:

    • riboflavin biosynthesis protein RibD
    • riboflavin specific deaminase
    • riboflavin biosynthesis protein
    • bifunctional pyrimidine reductase / riboflavin biosynthesis protein
    • bifunctional riboflavin biosynthesis protein
    • diaminohydroxyphosphoribosylaminopyrimidine deaminase
    • Diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase
  • strand?: -
  • coordinates?: 4705060..4706064
  • synteny block?: BlockID0034550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1820 (ribD)
    N315:
    SA1589 (ribD)
    NCTC8325:
    Newman:
    NWMN_1662 (ribD)
    USA300_FPR3757:
    04-02981:
    SA2981_1726 (ribD)
    08BA02176:
    C248_1816 (ribD)
    11819-97:
    MS7_1774 (ribD)
    71193:
    ST398NM01_1822
    ECT-R 2:
    ECTR2_1608 (ribD)
    ED133:
    SAOV_1754 (ribD)
    ED98:
    SAAV_1780 (ribD)
    HO 5096 0412:
    SAEMRSA15_16770 (ribD)
    JH1:
    SaurJH1_1858
    JH9:
    SaurJH9_1823
    JKD6008:
    SAA6008_01743 (ribD)
    JKD6159:
    SAA6159_01691 (ribD)
    LGA251:
    SARLGA251_16580 (ribD)
    M013:
    M013TW_1784
    MRSA252:
    SAR1853 (ribD)
    MSHR1132:
    SAMSHR1132_16180
    MSSA476:
    SAS1694
    Mu3:
    SAHV_1756 (ribD)
    Mu50:
    SAV1771 (ribD)
    MW2:
    MW1711 (ribD)
    RF122:
    SAB1628c (ribD)
    ST398:
    SAPIG1822 (ribD)
    T0131:
    SAT0131_01885
    TCH60:
    HMPREF0772_11383 (ribD)
    TW20:
    SATW20_17610 (ribD)
    USA300_TCH1516:
    USA300HOU_1760 (ribD)
    VC40:
    SAVC_08060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQFMDYAIQLANMVQGQTGVNPPVGAVVVKEGRIVGIGAHLRKGDKHAEVQALDMAQQN
    N315            MSQFMDYAIQLANMVQGQTGVNPPVGAVVVNEGRIVGIGAHLRKGDKHAEVQALDMAQQN
    NCTC8325        -------------MVQGQTGVNPPVGAVVVKEGRIVGIGAHLRKGDKHAEVQALDMAQQN
    Newman          MSQFMDYAIQLANMVQGQTGVNPPVGAVVVKEGRIVGIGAHLRKGDKHAEVQALDMAQQN
    USA300_FPR3757  -------------MVQGQTGVNPPVGAVVVKEGRIVGIGAHLRKGDKHAEVQALDMAQQN
                                 *****************:*****************************

    COL             AEGATIYITLEPCSHFGSTPPCVNKIIDCKIAKVVYATKDNSLDTHGDETLRAHGIEVEC
    N315            AEGATIYITLEPCSHFGSTPPCVNKIIDCKIAKVVYATKDNSLDTHGDETLRAHGIEVEC
    NCTC8325        AEGATIYITLEPCSHFGSTPPCVNKIIDCKIAKVVYATKDNSLDTHGDETLRAHGIEVEC
    Newman          AEGATIYITLEPCSHFGSTPPCVNKIIDCKIAKVVYATKDNSLDTHGDETLRAHGIEVEC
    USA300_FPR3757  AEGATIYITLEPCSHFGSTPPCVNKIIDCKIAKVVYATKDNSLDTHGDETLRAHGIEVEC
                    ************************************************************

    COL             VDDERASQLYQDFFKAKAKQLPQITVKVSASLDGKQANDNGQSQWITNKEVKQDVYKLRH
    N315            VDDERASQLYQDFFKAKAKQLPQITVKVSASLDGKQANDNGQSQWITNKEVKQDVYKLRH
    NCTC8325        VDDERASQLYQDFFKAKAKQLPQITVKVSASLDGKQANDNGQSQWITNKEVKQDVYKLRH
    Newman          VDDERASQLYQDFFKAKAKQLPQITVKVSASLDGKQANDNGQSQWITNKEVKQDVYKLRH
    USA300_FPR3757  VDDERASQLYQDFFKAKAKQLPQITVKVSASLDGKQANDNGQSQWITNKEVKQDVYKLRH
                    ************************************************************

    COL             RHDAVLTGRRTVELDDPQYTTRIQDGKNPIKVILSKSGNIHFNQQIYQDESTPIWIYTEN
    N315            RHDAVLTGRRTVELDDPQYTTRIQDGKNPIKVILSKSGNIHFNQQIYQDESTPIWIYTEN
    NCTC8325        RHDAVLTGRRTVELDDPQYTTRIQDGKNPIKVILSKSGNIHFNQQIYQDESTPIWIYTEN
    Newman          RHDAVLTGRRTVELDDPQYTTRIQDGKNPIKVILSKSGNIHFNQQIYQDESTPIWIYTEN
    USA300_FPR3757  RHDAVLTGRRTVELDDPQYTTRIQDGKNPIKVILSKSGNIHFNQQIYQDESTPIWIYTEN
                    ************************************************************

    COL             PNLTTNQTHIEIIYLKSCDLTTILHNLYKRGVGTLLVEAGPTTTSEFLQSNYIDEFILYY
    N315            PNLTSNQTHIEIIYLKSCDLTTILHNLYKRGVGTLLVEAGPTTTSEFLQSNYIDEFILYY
    NCTC8325        PNLTTNQTHIEIIYLKSCDLTTILHNLYKRGVGTLLVEAGPTTTSEFLQSNYIDEFILYY
    Newman          PNLTTNQTHIEIIYLKSCDLTTILHNLYKRGVGTLLVEAGPTTTSEFLQSNYIDEFILYY
    USA300_FPR3757  PNLTTNQTHIEIIYLKSCDLTTILHNLYKRGVGTLLVEAGPTTTSEFLQSNYIDEFILYY
                    ****:*******************************************************

    COL             APKLIGGSGNYQFYQTNDVIEIPDANQFEIVHSELLNQNVKLTLRKK
    N315            APKLIGGSGNYQFYQTNDVIEIPDANQFEIVHSELLNQNVKLTLRKK
    NCTC8325        APKLIGGSGNYQFYQTNDVIEIPDANQFEIVHSELLNQNVKLTLRKK
    Newman          APKLIGGSGNYQFYQTNDVIEIPDANQFEIVHSELLNQNVKLTLRKK
    USA300_FPR3757  APKLIGGSGNYQFYQTNDVIEIPDANQFEIVHSELLNQNVKLTLRKK
                    ***********************************************