From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004463000
  • symbol?: arsR
  • description?: arsenical resistance operon repressor-like protein

      descriptions from strain specific annotations:

    • arsenical resistance operon repressor-like protein
    • ArsR family transcriptional regulator
    • arsenate operon regulator
    • arsenical resistance operon repressor 2
  • strand?: +
  • coordinates?: 4708852..4709200
  • synteny block?: BlockID0034600
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1822 (arsR)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1728
    08BA02176:
    C248_1818 (arsR2)
    11819-97:
    71193:
    ST398NM01_2891
    ECT-R 2:
    ED133:
    SAOV_1756 (arsR)
    ED98:
    SAAV_1783 (arsR)
    HO 5096 0412:
    SAEMRSA15_16790 (arsR2)
    JH1:
    SaurJH1_1860
    JH9:
    SaurJH9_1825
    JKD6008:
    JKD6159:
    SAA6159_01693 (arsR)
    LGA251:
    M013:
    MRSA252:
    SAR1855 (arsR2)
    MSHR1132:
    SAMSHR1132_16200
    MSSA476:
    SAS1696
    Mu3:
    SAHV_1758
    Mu50:
    SAV1773
    MW2:
    MW1713
    RF122:
    SAB1630 (arsR)
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_08075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYH
    N315            -----------MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYH
    NCTC8325        -----------MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYH
    Newman          -----------MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYH
    USA300_FPR3757  MIIYLTSRRYVMTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYH
                               *************************************************

    COL             MKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
    N315            LKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCFCHNLKTGEC
    NCTC8325        MKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
    Newman          MKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
    USA300_FPR3757  MKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
                    :********************************************:*********