From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004465000
  • symbol?: arsC
  • description?: arsenate reductase

      descriptions from strain specific annotations:

    • arsenate reductase
    • protein ArsC
    • arsenate reductase (glutaredoxin)
  • strand?: +
  • coordinates?: 4710510..4710905
  • synteny block?: BlockID0034620
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1824 (arsC)
    N315:
    NCTC8325:
    Newman:
    NWMN_1666 (arsC)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    SAOV_1758
    ED98:
    HO 5096 0412:
    SAEMRSA15_16810 (arsC)
    JH1:
    JH9:
    JKD6008:
    SAA6008_01746 (arsC)
    JKD6159:
    LGA251:
    SARLGA251_16610 (arsC)
    M013:
    M013TW_1787
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    SAB1632
    ST398:
    T0131:
    SAT0131_01889
    TCH60:
    TW20:
    SATW20_17640 (arsC)
    USA300_TCH1516:
    USA300HOU_1764 (arsC2)
    VC40:
    SAVC_08085

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDIS
    NCTC8325        MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDIS
    Newman          MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDIS
    USA300_FPR3757  MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDIS
                    ************************************************************

    COL             NHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDE
    NCTC8325        NHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDE
    Newman          NHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDE
    USA300_FPR3757  NHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDE
                    ************************************************************

    COL             IKIAIENFKSR
    NCTC8325        IKIAIENFKSR
    Newman          IKIAIENFKSR
    USA300_FPR3757  IKIAIENFKSR
                    ***********