From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004469000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4714658..4714882
  • synteny block?: BlockID0034650
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1731
    08BA02176:
    C248_1821
    11819-97:
    MS7_1778
    71193:
    ST398NM01_1826
    ECT-R 2:
    ECTR2_1612
    ED133:
    SAOV_1760
    ED98:
    SAAV_1786
    HO 5096 0412:
    SAEMRSA15_16850
    JH1:
    SaurJH1_1863
    JH9:
    SaurJH9_1828
    JKD6008:
    SAA6008_01748
    JKD6159:
    SAA6159_01697
    LGA251:
    SARLGA251_16630
    M013:
    M013TW_1789
    MRSA252:
    SAR1858
    MSHR1132:
    SAMSHR1132_16230
    MSSA476:
    SAS1699
    Mu3:
    SAHV_1761
    Mu50:
    SAV1776
    MW2:
    MW1716
    RF122:
    SAB1634c
    ST398:
    SAPIG1826
    T0131:
    SAT0131_01891 (bacA)
    TCH60:
    HMPREF0772_11379
    TW20:
    SATW20_17660
    USA300_TCH1516:
    VC40:
    SAVC_08095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSN
    N315            MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSN
    NCTC8325        MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSN
    USA300_FPR3757  MDYAHLNLEHFFARNDDLDVIRDRADFVMINNFTNEMMYRDGQIEGTIDLNQYYYKNRSN
                    ************************************************************

    COL             AASFIMMDYKKETK
    N315            AASFIMMDYKKETK
    NCTC8325        AASFIMMDYKKETK
    USA300_FPR3757  AASFIMMDYKKETK
                    **************