From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004475000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 4716669..4717112
  • synteny block?: BlockID0034710
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1734
    08BA02176:
    C248_1824
    11819-97:
    MS7_1781
    71193:
    ST398NM01_1828
    ECT-R 2:
    ECTR2_1614
    ED133:
    SAOV_1763
    ED98:
    SAAV_1789
    HO 5096 0412:
    SAEMRSA15_16880
    JH1:
    SaurJH1_1866
    JH9:
    SaurJH9_1831
    JKD6008:
    JKD6159:
    SAA6159_01700
    LGA251:
    SARLGA251_16660
    M013:
    M013TW_1791
    MRSA252:
    SAR1861
    MSHR1132:
    SAMSHR1132_16260
    MSSA476:
    SAS1702
    Mu3:
    SAHV_1764
    Mu50:
    SAV1779
    MW2:
    MW1719
    RF122:
    SAB1637c
    ST398:
    SAPIG1828
    T0131:
    SAT0131_01894
    TCH60:
    HMPREF0772_11375
    TW20:
    SATW20_17690
    USA300_TCH1516:
    USA300HOU_1768
    VC40:
    SAVC_08110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKASFDKKVKKQLWFLNKKEKQALDQRLSSISDDDSVNLNKPVTFANAYLRQNVFRNKE
    N315            MNKASFDKKVKKQLWFLNKKEKQALDQRLSSISDDDSVNLNKPVTFANAYLRQNVFRNKE
    NCTC8325        MNKASFDKKVKKQLWFLNKKEKQALDQRLSSISDDDSVNLNKPVTFANAYLRQNVFRNKE
    Newman          MNKASFDKKVKKQLWFLNKKEKQALDQRLSSISDDDSVNLNKPVTFANAYLRQNVFRNKE
    USA300_FPR3757  MNKASFDKKVKKQLWFLNKKEKQALDQRLSSISDDDSVNLNKPVTFANAYLRQNVFRNKE
                    ************************************************************

    COL             TKSYSMFVTLVVMMFAYVALLGLFLFGLITSLSGVQFFVSPKVDLSTTVVILTIIGAILL
    N315            TKSYSMFVTLVVMMFAYVALLGLFLFGLITSLSGVQFFVSPKVDLSTTVVILTIIGAILL
    NCTC8325        TKSYSMFVTLVVMMFAYVALLGLFLFGLITSLSGVQFFVSPKVDLSTTVVILTIIGAILL
    Newman          TKSYSMFVTLVVMMFAYVALLGLFLFGLITSLSGVQFFVSPKVDLSTTVVILTIIGAILL
    USA300_FPR3757  TKSYSMFVTLVVMMFAYVALLGLFLFGLITSLSGVQFFVSPKVDLSTTVVILTIIGAILL
                    ************************************************************

    COL             MFASIYFIKIVTSYFTKKLLEIKFNSK
    N315            MIVSIYFIKIVTSYFTKKLLEIKFNSK
    NCTC8325        MFASIYFIKIVTSYFTKKLLEIKFNSK
    Newman          MFASIYFIKIVTSYFTKKLLEIKFNSK
    USA300_FPR3757  MFASIYFIKIVTSYFTKKLLEIKFNSK
                    *:.************************