From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004480000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 4721386..4721688
  • synteny block?: BlockID0034760
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1737
    08BA02176:
    C248_1829
    11819-97:
    MS7_1784
    71193:
    ST398NM01_1833
    ECT-R 2:
    ECTR2_1618
    ED133:
    SAOV_1766
    ED98:
    SAAV_1792
    HO 5096 0412:
    SAEMRSA15_16920
    JH1:
    SaurJH1_1869
    JH9:
    SaurJH9_1834
    JKD6008:
    JKD6159:
    SAA6159_01703
    LGA251:
    SARLGA251_16690
    M013:
    M013TW_1795
    MRSA252:
    SAR1865
    MSHR1132:
    SAMSHR1132_16300
    MSSA476:
    SAS1705
    Mu3:
    SAHV_1767
    Mu50:
    SAV1782
    MW2:
    MW1722
    RF122:
    SAB1640
    ST398:
    T0131:
    SAT0131_01897
    TCH60:
    HMPREF0772_11371
    TW20:
    SATW20_17720
    USA300_TCH1516:
    USA300HOU_1771
    VC40:
    SAVC_08125

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MSRSKKYFYLSSLMIILSFFFNTNNVFLSGFFNSFIKLILFCSVINSIVLILSIIFADRS
    NCTC8325        MSRSKKYFYLSSLMIILSFFFNTNNVFLSGLFNSFIKLILFCSVINSIVLILSIIFADRS
    Newman          MSRSKKYFYLSSLMIILSFFFNTNNVFLSGLFNSFIKLILFCSVINSIVLILSIIFADRS
                    ******************************:*****************************

    N315            IKSLKPDADWIRIASKSLPWIILIVILVHIFSIVRTFGFI
    NCTC8325        IKSLKPDADWIRIASKSLPWIILIVILVHIFSIVRTFGFI
    Newman          IKSLKPDADWIRIASKSLPWIILIVILVHIFSIVRTFGFI
                    ****************************************