From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004499000
  • symbol?:
  • description?: aldo/keto reductase family protein

      descriptions from strain specific annotations:

    • aldo/keto reductase family protein
    • aldo/keto reductase oxidoreductase
    • aldo/keto reductase family oxidoreductase
    • Oxidoreductase
    • 2,5-didehydrogluconate reductase
    • oxidoreductase of aldo/keto reductase family, subgroup 1
    • 2,5-diketo-D-gluconic acid reductase A (2,5-DKGreductase A) (2,5-DKGR A) (25DKGR-A) (AKR5C)
    • 2,5-diketo-D-gluconate reductase
    • aldo-keto reductase family protein
  • strand?: -
  • coordinates?: 4730933..4731786
  • synteny block?: BlockID0034900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1743
    08BA02176:
    C248_1832
    11819-97:
    MS7_1787
    71193:
    ST398NM01_1836
    ECT-R 2:
    ECTR2_1623
    ED133:
    SAOV_1769
    ED98:
    SAAV_1797
    HO 5096 0412:
    SAEMRSA15_16960
    JH1:
    SaurJH1_1875
    JH9:
    SaurJH9_1839
    JKD6008:
    SAA6008_01763
    JKD6159:
    SAA6159_01706
    LGA251:
    SARLGA251_16720
    M013:
    M013TW_1798
    MRSA252:
    SAR1868
    MSHR1132:
    SAMSHR1132_16330
    MSSA476:
    SAS1709
    Mu3:
    SAHV_1773
    Mu50:
    SAV1788
    MW2:
    MW1726
    RF122:
    SAB1643c
    ST398:
    SAPIG1836
    T0131:
    SAT0131_01902
    TCH60:
    HMPREF0772_11368 (dkgB)
    TW20:
    SATW20_17770
    USA300_TCH1516:
    USA300HOU_1775
    VC40:
    SAVC_08150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEVKTFYNGNTMPQIGLGTFRVENDENCMESVKYAIEQGYRSIDTAKVYGNEEQVGAGIR
    N315            MEVKTFYNGNTMPQIGLGTFRVENDENCMESVKYAIEQGYRSIDTAKVYGNEEQVGAGIR
    NCTC8325        MEVKTFYNGNTMPQIGLGTFRVENDENCMESVKYAIEQGYRSIDTAKVYGNEEQVGAGIR
    Newman          MEVKTFYNGNTMPQIGLGTFRVENDENCMESVKYAIEQGYRSIDTAKVYGNEEQVGAGIR
    USA300_FPR3757  MEVKTFYNGNTMPQIGLGTFRVENDENCMESVKYAIEQGYRSIDTAKVYGNEEQVGAGIR
                    ************************************************************

    COL             AGLESTGIAREDLFITSKLYFEDFGRENVAAAYEASLSRLGLKYLDLYLVHWPGTNEAVM
    N315            AGLESTGIAREDLFITSKLYFEDFGRENVAAAYEASLSRLGLKYLDLYLVHWPGTNEAVM
    NCTC8325        AGLESTGIAREDLFITSKLYFEDFGRENVAAAYEASLSRLGLKYLDLYLVHWPGTNEAVM
    Newman          AGLESTGIAREDLFITSKLYFEDFGRENVAAAYEASLSRLGLKYLDLYLVHWPGTNEAVM
    USA300_FPR3757  AGLESTGIAREDLFITSKLYFEDFGRENVAAAYEASLSRLGLKYLDLYLVHWPGTNEAVM
                    ************************************************************

    COL             VDTWKGMEDLYKNNNVKNIGVSNFEPEHLEALLAQVSIKPVINQVEYHPYLTQHKLKLYL
    N315            VDTWKGMEDLYKNNKAKNIGVSNFEPEHLEALLAQVSIKPVINQVEYHPYLTQHKLKLYL
    NCTC8325        VDTWKGMEDLYKNNNVKNIGVSNFEPEHLEALLAQVSIKPVINQVEYHPYLTQHKLKLYL
    Newman          VDTWKGMEDLYKNNNVKNIGVSNFEPEHLEALLAQVSIKPVINQVEYHPYLTQHKLKLYL
    USA300_FPR3757  VDTWKGMEDLYKNNNVKNIGVSNFEPEHLEALLAQVSIKPVINQVEYHPYLTQHKLKLYL
                    **************:.********************************************

    COL             AAQRIVMESWSPLMNAQILNDETIKDIAQELGKSPAQVVLRWNVQHAVVTIPKSVTPNRI
    N315            AAQHIVMESWSPLMNAQILNDETIKDIAQELGKSPAQVVLRWNVQHGVVIIPKSVTPNRI
    NCTC8325        AAQRIVMESWSPLMNAQILNDETIKDIAQELGKSPAQVVLRWNVQHAVVTIPKSVTPNRI
    Newman          AAQRIVMESWSPLMNAQILNDETIKDIAQELGKSPAQVVLRWNVQHAVVTIPKSVTPNRI
    USA300_FPR3757  AAQRIVMESWSPLMNAQILNDETIKDIAQELGKSPAQVVLRWNVQHAVVTIPKSVTPNRI
                    ***:******************************************.** **********

    COL             SENFQIFDFELSDEQMTRIDGLNQDKRIGPDPKKFEG
    N315            SENFQIFDFELSDEQMTRIDGLNQDKRIGPDPKTFEG
    NCTC8325        SENFQIFDFELSDEQMTRIDGLNQDKRIGPDPKKFEG
    Newman          SENFQIFDFELSDEQMTRIDGLNQDKRIGPDPKKFEG
    USA300_FPR3757  SENFQIFDFELSDEQMTRIDGLNQDKRIGPDPKKFEG
                    *********************************.***