From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004507000
  • symbol?:
  • description?: S9 family peptidase

      descriptions from strain specific annotations:

    • S9 family peptidase
    • Dipeptidyl aminopeptidase/acylaminoacyl-peptidase
    • acylamino-acid-releasing enzyme
    • dipeptidyl aminopeptidase/acylaminoacyl-peptidase-like protein
    • prolyl oligopeptidase
    • prolyl oligopeptidase family protein
  • strand?: -
  • coordinates?: 4737391..4738149
  • synteny block?: BlockID0034980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1748
    08BA02176:
    C248_1837
    11819-97:
    MS7_1791
    71193:
    ST398NM01_1840
    ECT-R 2:
    ECTR2_1627
    ED133:
    SAOV_1773
    ED98:
    SAAV_1802
    HO 5096 0412:
    SAEMRSA15_17000
    JH1:
    SaurJH1_1879
    JH9:
    SaurJH9_1843
    JKD6008:
    SAA6008_01768
    JKD6159:
    SAA6159_01710
    LGA251:
    SARLGA251_16760
    M013:
    M013TW_1802
    MRSA252:
    SAR1873
    MSHR1132:
    SAMSHR1132_16370
    MSSA476:
    SAS1713
    Mu3:
    SAHV_1778
    Mu50:
    SAV1793
    MW2:
    MW1731
    RF122:
    SAB1647c
    ST398:
    SAPIG1840
    T0131:
    SAT0131_01908
    TCH60:
    HMPREF0772_11364
    TW20:
    SATW20_17820
    USA300_TCH1516:
    USA300HOU_1780
    VC40:
    SAVC_08175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGFIKRKRMPIEYFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRA
    N315            MDFIKRKRMPIESFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRA
    NCTC8325        --------MPIEYFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRA
    Newman          MGFIKRKRMPIEYFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRA
    USA300_FPR3757  --------MPIEYFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRGGKGQVGRVRA
                            **** ***********************************************

    COL             GRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFS
    N315            GRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFS
    NCTC8325        GRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFS
    Newman          GRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFS
    USA300_FPR3757  GRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQLLRLLHDKYPHAFIHMVGFS
                    ************************************************************

    COL             RGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQA
    N315            RGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQA
    NCTC8325        RGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQA
    Newman          RGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQA
    USA300_FPR3757  RGGLQGLLTFQDLPVTSYTIWGGVSDIDLMYEERVDLRGMLRRMIGHPKKDRAAYEARQA
                    ************************************************************

    COL             IPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVE
    N315            IPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVE
    NCTC8325        IPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVE
    Newman          IPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVE
    USA300_FPR3757  IPNINENSPPILIVHGGKDQQVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVE
                    ************************************************************

    COL             TLTYIKEFMNQVESHS
    N315            TLTYIKEFMKQVELHS
    NCTC8325        TLTYIKEFMNQVESHS
    Newman          TLTYIKEFMNQVESHS
    USA300_FPR3757  TLTYIKEFMNQVESHS
                    *********:*** **