Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004510000
  • symbol?: menC
  • description?: o-succinylbenzoic acid synthetase

      descriptions from strain specific annotations:

    • o-succinylbenzoic acid synthetase
    • L-alanine-DL-glutamate epimerase/enolase superfamily-like protein
    • O-succinylbenzoate-CoA synthase
    • o-succinylbenzoic acid (OSB) synthetase
    • o-succinylbenzoic acid (OSB) synthetase, putative
    • NAAAR, N-acylamino acid racemase
    • o-succinylbenzoate synthase
  • strand?: -
  • coordinates?: 4738947..4739948
  • synteny block?: BlockID0035010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1614 (menC)
    NCTC8325:
    Newman:
    NWMN_1685 (menC)
    USA300_FPR3757:
    04-02981:
    SA2981_1751 (menC)
    08BA02176:
    C248_1840
    11819-97:
    MS7_1794 (menC)
    71193:
    ST398NM01_1842
    ECT-R 2:
    ECTR2_1629 (menC)
    ED133:
    SAOV_1776
    ED98:
    SAAV_1805
    HO 5096 0412:
    SAEMRSA15_17030
    JH1:
    SaurJH1_1882
    JH9:
    SaurJH9_1846
    JKD6008:
    SAA6008_01771
    JKD6159:
    SAA6159_01713
    LGA251:
    SARLGA251_16790
    M013:
    M013TW_1805
    MRSA252:
    SAR1876
    MSHR1132:
    SAMSHR1132_16400
    MSSA476:
    SAS1716
    Mu3:
    SAHV_1781 (menC)
    Mu50:
    SAV1796 (menC)
    MW2:
    MW1734 (menC)
    RF122:
    SAB1650c
    ST398:
    SAPIG1842 (menC)
    T0131:
    SAT0131_01911
    TCH60:
    HMPREF0772_11361 (menC)
    TW20:
    SATW20_17850
    USA300_TCH1516:
    USA300HOU_1783
    VC40:
    SAVC_08190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
    N315            MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
    NCTC8325        MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
    Newman          MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
    USA300_FPR3757  MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
                    ************************************************************

    COL             IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
    N315            IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
    NCTC8325        IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
    Newman          IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
    USA300_FPR3757  IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
                    ************************************************************

    COL             YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
    N315            YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
    NCTC8325        YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
    Newman          YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
    USA300_FPR3757  YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
                    ************************************************************

    COL             FTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVV
    N315            FTQLQLLAREQVLYIEEPFKDISMLDEVVDGTIPPIALDEKATSLLDIINLIELYNVKVV
    NCTC8325        FTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVV
    Newman          FTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVV
    USA300_FPR3757  FTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVV
                    ****************************.*******************************

    COL             VLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
    N315            VLKPFRLGGIDKVQTAIDTLKSHGVKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
    NCTC8325        VLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
    Newman          VLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
    USA300_FPR3757  VLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
                    ************************.***********************************

    COL             YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY
    N315            YFDQDVVTKSGILKEGRLEFRPPLVDITQLQPY
    NCTC8325        YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY
    Newman          YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY
    USA300_FPR3757  YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY
                    **:****::************************