From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004516000
  • symbol?:
  • description?: DUF4352 domain-containing protein

      descriptions from strain specific annotations:

    • DUF4352 domain-containing protein
    • membrane protein
    • telomeric repeat-binding factor 2 family protein
  • strand?: +
  • coordinates?: 4743207..4744259
  • synteny block?: BlockID0035070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1755
    08BA02176:
    C248_1844
    11819-97:
    MS7_1798
    71193:
    ST398NM01_1868
    ECT-R 2:
    ECTR2_1634
    ED133:
    SAOV_1780
    ED98:
    SAAV_1809
    HO 5096 0412:
    SAEMRSA15_17070
    JH1:
    SaurJH1_1886
    JH9:
    SaurJH9_1850
    JKD6008:
    SAA6008_01775
    JKD6159:
    SAA6159_01717
    LGA251:
    SARLGA251_16830
    M013:
    M013TW_1809
    MRSA252:
    SAR1880
    MSHR1132:
    SAMSHR1132_16440
    MSSA476:
    SAS1720
    Mu3:
    SAHV_1785
    Mu50:
    SAV1800
    MW2:
    MW1738
    RF122:
    SAB1654
    ST398:
    SAPIG1868
    T0131:
    SAT0131_01916 (gntP)
    TCH60:
    HMPREF0772_11357
    TW20:
    SATW20_17890
    USA300_TCH1516:
    USA300HOU_1787
    VC40:
    SAVC_08210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNQFKSEEERRQWEQFQAFQNQQNQQNQQYGQKKSKKGWFWGCGGCLVLFILIIIGISA
    N315            MSNQFKSEEERRQWEQFQAFQNQQNQQHQQYGQKKSKKGWFWGCGGCLVLFILIIIGISA
    NCTC8325        MSNQFKSEEERRQWEQFQAFQNQQNQQNQQYGQKKSKKGWFWGCGGCLVLFILIIIGISA
    Newman          MSNQFKSEEERRQWEQFQAFQNQQNQQNQQYGQKKSKKGWFWGCGGCLVLFILIIIGISA
    USA300_FPR3757  MSNQFKSEEERRQWEQFQAFQNQQNQQNQQYGQKKSKKGWFWGCGGCLVLFILIIIGISA
                    ***************************:********************************

    COL             CTAGITGNLGGNSSKETNKTHKIGETVKNGDLEVTVNSVETMKSVGPSLAPTNAKGIFVV
    N315            CTAGVTGNLGGNSSKEANKTHKIGETVKNGDLEVTVNSVETMKSVGPSLAPTNAKGIFVV
    NCTC8325        CTAGITGNLGGNSSKETNKTHKIGETVKNGDLEVTVNSVETMKSVGPSLAPTNAKGIFVV
    Newman          CTAGITGNLGGNSSKETNKTHKIGETVKNGDLEVTVNSVETMKSVGPSLAPTNAKGIFVV
    USA300_FPR3757  CTAGITGNLGGNSSKETNKTHKIGETVKNGDLEVTVNSVETMKSVGPSLAPTNAKGIFVV
                    ****:***********:*******************************************

    COL             ADVTIKNKGKEALTIDSSMFKLKSGDKTFEADNTGSMSANQSDNGSIENSFFLQRINPDS
    N315            ADVTIKNKGKEALTIDSSMFKLKSGDKTFEADNTGSMSANQSDNGSIENSFFLQRINPDS
    NCTC8325        ADVTIKNKGKEALTIDSSMFKLKSGDKTFEADNTGSMSANQSDNGSIENSFFLQRINPDS
    Newman          ADVTIKNKGKEALTIDSSMFKLKSGDKTFEADNTGSMSANQSDNGSIENSFFLQRINPDS
    USA300_FPR3757  ADVTIKNKGKEALTIDSSMFKLKSGDKTFEADNTGSMSANQSDNGSIENSFFLQRINPDS
                    ************************************************************

    COL             TAQGKIVFDVSENIANAKDKKLEVISSLFSVKKITFDLSDAKKTSKAKKDKQDTEVAVAS
    N315            TAQGKIVFDVSENIANAKDKKLEVISSLFSVKKITFDLSDAKKTSKAKKDKQDTEVAVAS
    NCTC8325        TAQGKIVFDVSENIANAKDKKLEVISSLFSVKKITFDLSDAKKTSKAKKDKQDTEVAVAS
    Newman          TAQGKIVFDVSENIANAKDKKLEVISSLFSVKKITFDLSDAKKTSKAKKDKQDTEVAVAS
    USA300_FPR3757  TAQGKIVFDVSENIANAKDKKLEVISSLFSVKKITFDLSDAKKTSKAKKDKQDTEVAVAS
                    ************************************************************

    COL             SNSDNVSYEASATTPATTSSADTDSEDSEKSSKDEDKQNASKSDKSSVEKSESNEETAPV
    N315            SNSDNVNYEASATTPATTSSADTDSEDSEKSSKDEDKQNASKSDKSSVEKSESNEETATV
    NCTC8325        SNSDNVSYEASATTPATTSSADTDSEDSEKSSKDEDKQNASKSDKSSVEKSESNEETAPV
    Newman          SNSDNVSYEASATTPATTSSADTDSEDSEKSSKDEDKQNASKSDKSSVEKSESNEETAPV
    USA300_FPR3757  SNSDNVSYEASATTPATTSSADTDSEDSEKSSKDEDKQNASKSDKSSVEKSESNEETAPV
                    ******.***************************************************.*

    COL             EPMPHSKPTTSEAPPSQNIHNEDSMYDASTE
    N315            EPMPQSKPTTSEAPPSQNNHNENNMYDASTE
    NCTC8325        EPMPHSKPTTSEAPPSQNIHNEDSMYDASTE
    Newman          EPMPHSKPTTSEAPPSQNIHNEDSMYDASTE
    USA300_FPR3757  EPMPHSKPTTSEAPPSQNIHNEDSMYDASTE
                    ****:************* ***:.*******