From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004556000
  • symbol?: hsdM2
  • description?: type I restriction-modification system subunit M

      descriptions from strain specific annotations:

    • type I restriction-modification system subunit M
    • type I restriction-modification system, M subunit
    • type I restriction-modification system, methyltransferase subunit
    • type I restriction-modification system modification protein
    • type I restriction enzyme EcoR124II M protein
    • type I restriction enzyme modification protein
    • Type I restriction-modification system, DNA-methyltransferase subunit M
    • type I restriction-modification system DNA-methyltransferase
    • type I restriction-modification system M subunit
    • type I site-specific deoxyribonuclease methyltransferase subunit
  • strand?: -
  • coordinates?: 4780164..4788405
  • synteny block?: BlockID0035460
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1862 (hsdM2)
    N315:
    NCTC8325:
    Newman:
    NWMN_1700 (hsdM)
    USA300_FPR3757:
    04-02981:
    SA2981_1763
    08BA02176:
    11819-97:
    MS7_1808
    71193:
    ECT-R 2:
    ECTR2_1641 (hsdM)
    ED133:
    SAOV_1794
    ED98:
    SAAV_1816 (hsdM)
    HO 5096 0412:
    JH1:
    SaurJH1_1895
    JH9:
    SaurJH9_1860
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_16900
    M013:
    MRSA252:
    SAR1899
    MSHR1132:
    MSSA476:
    SAS1732
    Mu3:
    SAHV_1793
    Mu50:
    SAV1808
    MW2:
    MW1751 (hsdM)
    RF122:
    SAB1668c (hsdM)
    ST398:
    T0131:
    SAT0131_01928
    TCH60:
    HMPREF0772_11335
    TW20:
    SATW20_18050
    USA300_TCH1516:
    USA300HOU_1800 (hsdM2)
    VC40:
    SAVC_08275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------------------------------------------
    N315            ------------------------------------------------------------
    NCTC8325        MILKAFESYNISIKFFNNNCATKTQNFHHQHPNYQHRNITKCYNKSITQRDKLLMQRRRN
    Newman          MILKAFESYNISIKFFNNNCATKTQNFHHQHPNYQHRNITKCYNKSITQRDKLLMQRRRN
    USA300_FPR3757  MILKAFESYNISIKFFNNNCATKTQNFHHQHPNYQHRNITKCYNKSITQRDKLLMQRRRN
                                                                                

    COL             -MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADAL
    N315            -MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADAL
    NCTC8325        HMSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADAL
    Newman          HMSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADAL
    USA300_FPR3757  HMSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADAL
                     ***********************************************************

    COL             SGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIR
    N315            SGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIR
    NCTC8325        SGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIR
    Newman          SGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIR
    USA300_FPR3757  SGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIR
                    ************************************************************

    COL             KVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEID
    N315            KVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEID
    NCTC8325        KVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEID
    Newman          KVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEID
    USA300_FPR3757  KVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEID
                    ************************************************************

    COL             MLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLL
    N315            MLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLL
    NCTC8325        MLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLL
    Newman          MLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLL
    USA300_FPR3757  MLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLL
                    ************************************************************

    COL             RVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVI
    N315            RVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFEIRNDDTLENPAFLGNTFDAVI
    NCTC8325        RVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFEIRNDDTLENPAFLGNTFDAVI
    Newman          RVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVI
    USA300_FPR3757  RVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVI
                    **************************************:*********************

    COL             ANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVL
    N315            ANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVL
    NCTC8325        ANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVL
    Newman          ANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVL
    USA300_FPR3757  ANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVL
                    ************************************************************

    COL             FRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASN
    N315            FRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASN
    NCTC8325        FRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASN
    Newman          FRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASN
    USA300_FPR3757  FRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASN
                    ************************************************************

    COL             DFEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEE
    N315            DFEKGKNQNHLSDAQVERIIDTYKRKATIDKYSYSATLQEIADNDYNLNIPRYVDTFEEE
    NCTC8325        DFEKGKNQNHLSDAQVERIIDTYKRKATIDKYSYSATLQEIADNDYNLNIPRYVDTFEEE
    Newman          DFEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEE
    USA300_FPR3757  DFEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEE
                    ************************** *********************************

    COL             APIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    N315            APIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    NCTC8325        APIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    Newman          APIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    USA300_FPR3757  APIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
                    ***************************************