From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004592000
  • symbol?: lukE
  • description?: leukotoxin LukE

      descriptions from strain specific annotations:

    • leukotoxin LukE
    • gamma-hemolysin subunit A
    • leukocidin LukE precursor
    • beta-channel forming cytolysin
    • gamma-hemolysin component A precursor
    • Leukocidin LukE
    • leukocidin-S subunit
    • leukotoxin, LukE
    • leukotoxin E subunit
    • leukotoxin S-subunit
    • pseudogene
  • strand?: -
  • coordinates?: 4829616..4830521
  • synteny block?: BlockID0035700
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1881 (lukE)
    N315:
    SA1638 (lukE)
    NCTC8325:
    Newman:
    NWMN_1719 (lukE)
    USA300_FPR3757:
    04-02981:
    SA2981_1775 (lukE)
    08BA02176:
    11819-97:
    MS7_1825 (lukE)
    71193:
    ECT-R 2:
    ECTR2_1653
    ED133:
    SAOV_1813c (lukE)
    ED98:
    SAAV_1829 (lukE)
    HO 5096 0412:
    JH1:
    SaurJH1_1905
    JH9:
    SaurJH9_1871
    JKD6008:
    JKD6159:
    SAA6159_01751 (lukE)
    LGA251:
    SARLGA251_17090 (hlgA)
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1749 (hlgA)
    Mu3:
    SAHV_1805 (lukE)
    Mu50:
    SAV1820 (lukE)
    MW2:
    MW1768 (lukE)
    RF122:
    SAB1687c (lukE)
    ST398:
    T0131:
    SAT0131_01947 (recQ1)
    TCH60:
    TW20:
    SATW20_18220 (hlgA)
    USA300_TCH1516:
    USA300HOU_1818 (lukE)
    VC40:
    SAVC_08365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKKKMLAATLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQ
    N315            MFKKKMLAATLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQ
    NCTC8325        ----------MSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQ
    Newman          MFKKKMLAATLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQ
    USA300_FPR3757  MFKKKMLAATLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQ
                              :*************************************************

    COL             FDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVS
    N315            FDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVS
    NCTC8325        FDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVS
    Newman          FDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVS
    USA300_FPR3757  FDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVS
                    ************************************************************

    COL             LINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQN
    N315            LINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQN
    NCTC8325        LINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQN
    Newman          LINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQN
    USA300_FPR3757  LINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQN
                    ************************************************************

    COL             SKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPS
    N315            SKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPS
    NCTC8325        SKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPS
    Newman          SKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPS
    USA300_FPR3757  SKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPS
                    ************************************************************

    COL             FITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNW
    N315            FITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNW
    NCTC8325        FITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNW
    Newman          FITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNW
    USA300_FPR3757  FITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNW
                    ************************************************************

    COL             KTHEIKVKGHN
    N315            KTHEIKVKGHN
    NCTC8325        KTHEIKVKGHN
    Newman          KTHEIKVKGHN
    USA300_FPR3757  KTHEIKVKGHN
                    ***********