Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004604000
  • symbol?:
  • description?: Prophage protein

      descriptions from strain specific annotations:

    • Prophage protein
    • pseudogene
  • strand?: +
  • coordinates?: 4837012..4837654
  • synteny block?: BlockID0035800
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1776
    08BA02176:
    11819-97:
    MS7_1827
    71193:
    ECT-R 2:
    ECTR2_1654
    ED133:
    ED98:
    SAAV_1830
    HO 5096 0412:
    JH1:
    SaurJH1_1907
    JH9:
    SaurJH9_1874
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_1828
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1751
    Mu3:
    SAHV_1806
    Mu50:
    SAV1821
    MW2:
    MW1770
    RF122:
    ST398:
    T0131:
    SAT0131_01949
    TCH60:
    TW20:
    SATW20_18240
    USA300_TCH1516:
    USA300HOU_1820
    VC40:
    SAVC_08375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTFDAKKLKKEYLDWYNQTLEFSNLSNNVVRIDTPFKDNSLDNLIIYALYDQSRDMITL
    N315            MTTFDAKKLKKEYLDWYNQILEFSNLSNNSVKIDTPFKDNSLDNLKIYALYDQSRDMITL
    NCTC8325        MTTFDAKKLKKEYLDWYNQTLEFSNLSNNVVRIDTPFKDNSLDNLIIYALYDQSRDMITL
    Newman          MTTFDAKKLKKEYLDWYNQTLEFSNLSNNVVRIDTPFKDNSLDNLIIYALYDQSRDMITL
    USA300_FPR3757  MTTFDAKKLKKEYLDWYNQTLEFSNLSNNVVRIDTPFKDNSLDNLIIYALYDQSRDMITL
                    ******************* ********* *:************* **************

    COL             TDDGYTIFDLENNGISLNKSKKRKKIFEEHLSAYGIKYNDKTHEIFVQTNFKNFNKSKHN
    N315            TDDGYTIFGLENNGVSINKFKKRKKIFEEHLSAYGIKYNDKTHEIFVQTNFKNFNKSKHN
    NCTC8325        TDDGYTIFDLENNGISLNKSKKRKKIFEEHLSAYGIKYNDKTHEIFVQTNFKNFNKSKHN
    Newman          TDDGYTIFDLENNGISLNKSKKRKKIFEEHLSAYGIKYNDKTHEIFVQTNFKNFNKSKHN
    USA300_FPR3757  TDDGYTIFDLENNGISLNKSKKRKKIFEEHLSAYGIKYNDKTHEIFVQTNFKNFNKSKHN
                    ********.*****:*:** ****************************************

    COL             LLQCLIFVNDMYLLSNPKSQNIFTEDVANKLDEHNIYYGRDLPIIGSSGVVHNFDFFISA
    N315            LLQCLIFVNDMYLLSNPKSQNIFTEDVANKLDEHNIYYGRDIPIIGSSGVVHNFDFFISA
    NCTC8325        LLQCLIFVNDMYLLSNPKSQNIFTEDVANKLDEHNIYYGRDLPIIGSSGVVHNFDFFISA
    Newman          LLQCLIFVNDMYLLSNPKSQNIFTEDVANKLDEHNIYYGRDLPIIGSSGVVHNFDFFISA
    USA300_FPR3757  LLQCLIFVNDMYLLSNPKSQNIFTEDVANKLDEHNIYYGRDLPIIGSSGVVHNFDFFISA
                    *****************************************:******************

    COL             KKNQKEKFINAISNPNNSMIIKSKITDAMQAKKIKRHRQNEFIFILNDSKKEINEHNKNL
    N315            KKNQKEKFINVFSNPNNSMIIKSKITDAMQAKKIKRHRQNEFIFILNDSKKEINEHNKNL
    NCTC8325        KKNQKEKFINAISNPNNSMIIKSKITDAMQAKKIKRHRQNEFIFILNDSKKEINEHNKNL
    Newman          KKNQKEKFINAISNPNNSMIIKSKITDAMQAKKIKRHRQNEFIFILNDSKKEINEHNKNL
    USA300_FPR3757  KKNQKEKFINAISNPNNSMIIKSKITDAMQAKK---------------------------
                    **********.:*********************                           

    COL             LHENYISTIDYSELDEKIGLLI
    N315            LHENYISTIDYSELDEKIGLLI
    NCTC8325        LHENYISTIDYSELDEKIGLLI
    Newman          LHENYISTIDYSELDEKIGLLI
    USA300_FPR3757  ----------------------