From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004761000
  • symbol?:
  • description?: multidrug ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • multidrug ABC transporter ATP-binding protein
    • putative ABC transporter protein EcsB
    • ABC transporter EcsB
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter
    • ABC transporter ATP-binding protein
    • ABC transporter permease EscB
    • ABC transporter protein EcsB family protein
    • ABC-type exoprotein transport system, permease component
    • bacterial ABC transporter EcsB family protein
    • putative transporter protein
  • strand?: -
  • coordinates?: 4974710..4975837
  • synteny block?: BlockID0036930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1792 (ecsB)
    08BA02176:
    C248_1877
    11819-97:
    MS7_1841
    71193:
    ST398NM01_1901
    ECT-R 2:
    ECTR2_1678
    ED133:
    SAOV_1831
    ED98:
    SAAV_1855
    HO 5096 0412:
    SAEMRSA15_17400
    JH1:
    SaurJH1_1923
    JH9:
    SaurJH9_1889
    JKD6008:
    SAA6008_01793 (ecsB)
    JKD6159:
    SAA6159_01764 (ecsB)
    LGA251:
    SARLGA251_17190
    M013:
    M013TW_1842
    MRSA252:
    SAR1927
    MSHR1132:
    SAMSHR1132_16820
    MSSA476:
    SAS1757
    Mu3:
    SAHV_1821
    Mu50:
    SAV1836
    MW2:
    MW1776
    RF122:
    SAB1767c
    ST398:
    SAPIG1901
    T0131:
    SAT0131_01956
    TCH60:
    HMPREF0772_11309
    TW20:
    SATW20_18300
    USA300_TCH1516:
    USA300HOU_1828
    VC40:
    SAVC_08410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNQATTLFNKRLHALRKEKNYYNKFIFNGHFMVFLLILLGAFIFGYGEWLKHIPTNINF
    N315            MHNQATTLFNKRLHALRKEKNYYNKFIFNGHFMVFLLILLGAFIFGYGEWLKHIPTNINF
    NCTC8325        MRNQATTLFNKRLHALRKEKNYYNKFIFNGHFMVFLLILLGAFIFGYGEWLKHIPTNINF
    Newman          MRNQATTLFNKRLHALRKEKNYYNKFIFNGHFMVFLLILLGAFIFGYGEWLKHIPTNINF
    USA300_FPR3757  MRNQATTLFNKRLHALRKEKNYYNKFIFNGHFMVFLLILLGAFIFGYGEWLKHIPTNINF
                    *:**********************************************************

    COL             SLIAAVIVALTSIFPMRPLLKEADKIFLLPFEKHMSQFMRHAILYSYFARILIQLIIVIV
    N315            ALIAAVIVALTSIFPMRPLLKEADKIFLLPFEKHMSQFMRHAILYSYFARILIQLIIVIV
    NCTC8325        SLIAAVIVALTSIFPMRPLLKEADKIFLLPFEKHMSQFMRHAILYSYFARILIQLIIVIV
    Newman          SLIAAVIVALTSIFPMRPLLKEADKIFLLPFEKHMSQFMRHAILYSYFARILIQLIIVIV
    USA300_FPR3757  SLIAAVIVALTSIFPMRPLLKEADKIFLLPFEKHMSQFMRHAILYSYFARILIQLIIVIV
                    :***********************************************************

    COL             MFPLFYNINQHNVAFYICFGVSALIFPYVGLRLRWQWYQSGLKTWQVNLISFITFALTYY
    N315            MFPLFYNINQHNVAFYICFGFSALIFPYVGLRLRWQWYQSGLKTWQVNLISFIIFALTYY
    NCTC8325        MFPLFYNINQHNVAFYICFGVSALIFPYVGLRLRWQWYQSGLKTWQVNLISFITFALTYY
    Newman          MFPLFYNINQHNVAFYICFGVSALIFPYVGLRLRWQWYQSGLKTWQVNLISFITFALTYY
    USA300_FPR3757  MFPLFYNINQHNVAFYICFGVSALIFPYVGLRLRWQWYQSGLKTWQVNLISFITFALTYY
                    ********************.******************************** ******

    COL             LLLAPKWYIAFVMVALPVLIEFLVKKYKPGFLYPWEKMIAIEHRHHMNYYKFVNMFTDVK
    N315            LLLAPKWYIVFVMVALPVLIEFLVKKYKPGFLYPWEKMIAIEHRHHMNYYKFVNMFTDVK
    NCTC8325        LLLAPKWYIAFVMVALPVLIEFLVKKYKPGFLYPWEKMIAIEHRHHMNYYKFVNMFTDVK
    Newman          LLLAPKWYIAFVMVALPVLIEFLVKKYKPGFLYPWEKMIAIEHRHHMNYYKFVNMFTDVK
    USA300_FPR3757  LLLAPKWYIAFVMVALPVLIEFLVKKYKPGFLYPWEKMIAIEHRHHMNYYKFVNMFTDVK
                    *********.**************************************************

    COL             HLKESAVRRSYLDILLPVPKGSKFNSNAMYLFLFIRSFIRGRDAFNIIFRLVIIAVLLMV
    N315            HLKESAVRRSYLDILLPVPKGSKFNSNAMYLFLFIRSFIRGRDAFNIIFRLVIIAVLLMV
    NCTC8325        HLKESAVRRSYLDILLPVPKGSKFNSNAMYLFLFIRSFIRGRDAFNIIFRLVIIAVLLMV
    Newman          HLKESAVRRSYLDILLPVPKGSKFNSNAMYLFLFIRSFIRGRDAFNIIFRLVIIAVLLMV
    USA300_FPR3757  HLKESAVRRSYLDILLPVPKGSKFNSNAMYLFLFIRSFIRGRDAFNIIFRLVIIAVLLMV
                    ************************************************************

    COL             WLSYPLVTAIIGCLFVYIILLQMAQFYSQQAYGLWPQVWPVPEEKVIKGYEQFLYRLMFV
    N315            WLSYPLVTGVIGSLFVYIILLQMAQFYSQQAYGLWPQVWPVPEEKVIKGYEQFLYRLMFV
    NCTC8325        WLSYPLVTAIIGCLFVYIILLQMAQFYSQQAYGLWPQVWPVPEEKVIKGYEQFLYRLMFV
    Newman          WLSYPLVTAIIGCLFVYIILLQMAQFYSQQAYGLWPQVWPVPEEKVIKGYEQFLYRLMFV
    USA300_FPR3757  WLSYPLVTAIIGCLFVYIILLQMAQFYSQQAYGLWPQVWPVPEEKVIKGYEQFLYRLMFV
                    ********.:**.***********************************************

    COL             ICTVFAVTFIIKHMTLFYVVLIFYIVGLLTIRSIIKKLKYQETLLRD
    N315            ICTVFAVTFIIKHMTLFYVVLIFYIVGLLTIRSIIKKLKYQETLLRD
    NCTC8325        ICTVFAVTFIIKHMTLFYVVLIFYIVGLLTIRSIIKKLKYQETLLRD
    Newman          ICTVFAVTFIIKHMTLFYVVLIFYIVGLLTIRSIIKKLKYQETLLRD
    USA300_FPR3757  ICTVFAVTFIIKHMTLFYVVLIFYIVGLLTIRSIIKKLKYQETLLRD
                    ***********************************************