From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004762000
  • symbol?: ecsA
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein EcsA
    • ABC-type transporter ATP-binding protein ecsA
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter
    • ABC transporter ecsA
    • ATP-binding ABC transporter
    • multidrug ABC transporter
  • strand?: -
  • coordinates?: 4975926..4976666
  • synteny block?: BlockID0036940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1793 (ecsA)
    08BA02176:
    C248_1878
    11819-97:
    MS7_1842 (ecsA)
    71193:
    ST398NM01_1902
    ECT-R 2:
    ECTR2_1679
    ED133:
    SAOV_1832
    ED98:
    SAAV_1856
    HO 5096 0412:
    SAEMRSA15_17410
    JH1:
    SaurJH1_1924
    JH9:
    SaurJH9_1890
    JKD6008:
    SAA6008_01794 (ccmA)
    JKD6159:
    SAA6159_01765 (ccmA)
    LGA251:
    SARLGA251_17200
    M013:
    M013TW_1843
    MRSA252:
    SAR1928
    MSHR1132:
    SAMSHR1132_16830
    MSSA476:
    SAS1758
    Mu3:
    SAHV_1822
    Mu50:
    SAV1837
    MW2:
    MW1777
    RF122:
    SAB1768c
    ST398:
    SAPIG1902
    T0131:
    SAT0131_01957
    TCH60:
    HMPREF0772_11308
    TW20:
    SATW20_18310
    USA300_TCH1516:
    USA300HOU_1829
    VC40:
    SAVC_08415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVKVEQLTGGYGKRPVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLS
    N315            MTVKVEQLTGGYGKRPVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLS
    NCTC8325        MTVKVEQLTGGYGKRPVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLS
    Newman          MTVKVEQLTGGYGKRPVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLS
    USA300_FPR3757  MTVKVEQLTGGYGKRPVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLS
                    ************************************************************

    COL             ISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDETMNRAMPLLKT
    N315            ISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDEAMNRAMPLLKT
    NCTC8325        ISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDETMNRAMPLLKT
    Newman          ISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDETMNRAMPLLKT
    USA300_FPR3757  ISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDETMNRAMPLLKT
                    *************************************************:**********

    COL             FRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKK
    N315            FRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKK
    NCTC8325        FRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKK
    Newman          FRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKK
    USA300_FPR3757  FRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKK
                    ************************************************************

    COL             NEGRTVLMSTHILATAERYCDRFIILDEGEVVAFGDLEALRQQTGLHNQTLDDIYIHVTQ
    N315            NEGRTVLMSTHILATAERYCDRFIILDEGEVVAFGDLEALRQQTGLHNQTLDDIYIHVTQ
    NCTC8325        NEGRTVLMSTHILATAERYCDRFIILDEGEVVAFGDLEALRQQTGLHNQTLDDIYIHVTQ
    Newman          NEGRTVLMSTHILATAERYCDRFIILDEGEVVAFGDLEALRQQTGLHNQTLDDIYIHVTQ
    USA300_FPR3757  NEGRTVLMSTHILATAERYCDRFIILDEGEVVAFGDLEALRQQTGLHNQTLDDIYIHVTQ
                    ************************************************************

    COL             GGDVHA
    N315            GGDVHA
    NCTC8325        GGDVHA
    Newman          GGDVHA
    USA300_FPR3757  GGDVHA
                    ******