Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004763000
  • symbol?: hit
  • description?: cell-cycle regulation Hit-like protein

      descriptions from strain specific annotations:

    • cell-cycle regulation Hit-like protein
    • HIT family protein
    • histidine triad (HIT) protein
    • Hit-family protein involved in cell-cycle regulation
    • HIT histidine triad cell-cycle regulator
    • Bis(5-nucleosyl)-tetraphosphatase (asymmetrical)
    • HIT family hydrolase
    • protein hit
    • cell cycle regulation protein
    • Histidine triad (HIT) nucleotide-binding protein
    • adenosine 5'-monophosphoramidase
  • strand?: +
  • coordinates?: 4976779..4977222
  • synteny block?: BlockID0036950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1656 (hit)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1794 (hit)
    08BA02176:
    C248_1879
    11819-97:
    MS7_1843 (hit)
    71193:
    ST398NM01_1903
    ECT-R 2:
    ECTR2_1680
    ED133:
    SAOV_1833
    ED98:
    SAAV_1857
    HO 5096 0412:
    SAEMRSA15_17420
    JH1:
    SaurJH1_1925
    JH9:
    SaurJH9_1891
    JKD6008:
    SAA6008_01795 (hit)
    JKD6159:
    SAA6159_01766 (hit)
    LGA251:
    SARLGA251_17210
    M013:
    M013TW_1844
    MRSA252:
    SAR1929
    MSHR1132:
    SAMSHR1132_16840
    MSSA476:
    SAS1759
    Mu3:
    SAHV_1823 (hit)
    Mu50:
    SAV1838 (hit)
    MW2:
    MW1778 (hit)
    RF122:
    SAB1769
    ST398:
    SAPIG1903
    T0131:
    SAT0131_01958
    TCH60:
    HMPREF0772_11307 (hit)
    TW20:
    SATW20_18320
    USA300_TCH1516:
    USA300HOU_1830
    VC40:
    SAVC_08420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKH
    N315            MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKH
    NCTC8325        MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKH
    Newman          MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKH
    USA300_FPR3757  MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKH
                    ************************************************************

    COL             IGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETH
    N315            IGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETH
    NCTC8325        IGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETH
    Newman          IGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETH
    USA300_FPR3757  IGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETH
                    ************************************************************

    COL             EDILDNDAKQQIAEQIQAQF
    N315            EDILDNDAKQQIAEQIQAQF
    NCTC8325        EDILDNDAKQQIAEQIQAQF
    Newman          EDILDNDAKQQIAEQIQAQF
    USA300_FPR3757  EDILDNDAKQQIAEQIQAQF
                    ********************