From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004771000
  • symbol?: prsA
  • description?: peptidyl-prolyl cis-trans isomerase

      descriptions from strain specific annotations:

    • peptidyl-prolyl cis-trans isomerase
    • PpiC-type peptidyl-prolyl cis-trans isomerase
    • peptidyl-prolyl cis/trans isomerase
    • protein export protein PrsA, putative
    • Foldase protein PrsA precursor
    • PPIC-type PPIASE domain-containing protein
    • peptidyl-prolyl cis-isomerase
    • foldase protein PrsA
    • peptidylprolyl isomerase
    • putative peptidyl-prolyl cis-isomerase
    • peptidylprolyl isomerase, PrsA
  • strand?: +
  • coordinates?: 4979457..4980274
  • synteny block?: BlockID0037030
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1659 (prsA)
    NCTC8325:
    Newman:
    NWMN_1733 (prsA)
    USA300_FPR3757:
    04-02981:
    SA2981_1797 (prsA)
    08BA02176:
    C248_1883
    11819-97:
    MS7_1846 (prsA)
    71193:
    ST398NM01_1907
    ECT-R 2:
    ECTR2_1683
    ED133:
    SAOV_1837
    ED98:
    SAAV_1860
    HO 5096 0412:
    SAEMRSA15_17460
    JH1:
    SaurJH1_1928
    JH9:
    SaurJH9_1894
    JKD6008:
    SAA6008_01798 (prsA)
    JKD6159:
    SAA6159_01769 (prsA)
    LGA251:
    SARLGA251_17240
    M013:
    M013TW_1847
    MRSA252:
    SAR1932
    MSHR1132:
    SAMSHR1132_16870
    MSSA476:
    SAS1762
    Mu3:
    SAHV_1826 (prsA)
    Mu50:
    SAV1841 (prsA)
    MW2:
    MW1782 (prsA)
    RF122:
    SAB1774
    ST398:
    SAPIG1907
    T0131:
    SAT0131_01961
    TCH60:
    HMPREF0772_11303 (prsA2)
    TW20:
    SATW20_18350
    USA300_TCH1516:
    USA300HOU_1833 (prsA2)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
    N315            MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
    NCTC8325        MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
    Newman          MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
    USA300_FPR3757  MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
                    ************************************************************

    COL             TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
    N315            TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
    NCTC8325        TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
    Newman          TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
    USA300_FPR3757  TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
                    ************************************************************

    COL             YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
    N315            YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
    NCTC8325        YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
    Newman          YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
    USA300_FPR3757  YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
                    ************************************************************

    COL             PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
    N315            PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
    NCTC8325        PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
    Newman          PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
    USA300_FPR3757  PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
                    ************************************************************

    COL             IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
    N315            IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
    NCTC8325        IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
    Newman          IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
    USA300_FPR3757  IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
                    ************************************************************

    COL             LNPEKLKQGGAQGGQSGMSQ
    N315            LNPEKLKQGGAQGGQSGMSQ
    NCTC8325        LNPEKLKQGGAQGGQSGMSQ
    Newman          LNPEKLKQGGAQGGQSGMSQ
    USA300_FPR3757  LNPEKLKQGGAQGGQSGMSQ
                    ********************