From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004773000
  • symbol?:
  • description?: DNA double-strand break repair Rad50 ATPase

      descriptions from strain specific annotations:

    • DNA double-strand break repair Rad50 ATPase
    • DNA double-strand break repair ATPase
    • large conserved outer membrane protein
    • membrane associated protein
  • strand?: -
  • coordinates?: 4981557..4984493
  • synteny block?: BlockID0037050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1799
    08BA02176:
    C248_1885
    11819-97:
    MS7_1848
    71193:
    ST398NM01_1909
    ECT-R 2:
    ECTR2_1685
    ED133:
    SAOV_1839
    ED98:
    SAAV_1862
    HO 5096 0412:
    SAEMRSA15_17480
    JH1:
    SaurJH1_1930
    JH9:
    SaurJH9_1896
    JKD6008:
    SAA6008_01800
    JKD6159:
    SAA6159_01771
    LGA251:
    SARLGA251_17260
    M013:
    M013TW_1849
    MRSA252:
    SAR1934
    MSHR1132:
    SAMSHR1132_16890
    MSSA476:
    SAS1764
    Mu3:
    SAHV_1828
    Mu50:
    SAV1843
    MW2:
    MW1784
    RF122:
    SAB1776c
    ST398:
    SAPIG1909
    T0131:
    SAT0131_01963
    TCH60:
    HMPREF0772_11301
    TW20:
    SATW20_18370
    USA300_TCH1516:
    USA300HOU_1835
    VC40:
    SAVC_08455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIIKSLEIYGYGQFVQRKIEFNKNFTEIFGENEAGKSTIQAFIHSILFGFPTKKSKEPRL
    N315            MIIKSLEIYGYGQFVQRKIEFNKNFTEIFGENEAGKSTIQAFIHSILFGFPTKKSKEPRL
    NCTC8325        MIIKSLEIYGYGQFVQRKIEFNKNFTEIFGENEAGKSTIQAFIHSILFGFPTKKSKEPRL
    Newman          MIIKSLEIYGYGQFVQRKIEFNKNFTEIFGENEAGKSTIQAFIHSILFGFPTKKSKEPRL
    USA300_FPR3757  MIIKSLEIYGYGQFVQRKIEFNKNFTEIFGENEAGKSTIQAFIHSILFGFPTKKSKEPRL
                    ************************************************************

    COL             EPRLGNQYGGKLVLILDDGLEIEVERIKGSAQGDVKVYLPNGAVRDDAWLQKKLNYISKK
    N315            EPRLGNQYGGKLVLILDDGLEIEVERIKGSAQGDVKVYLPNGAVRDDAWLQKKLNYISKK
    NCTC8325        EPRLGNQYGGKLVLILDDGLEIEVERIKGSAQGDVKVYLPNGAVRDDAWLQKKLNYISKK
    Newman          EPRLGNQYGGKLVLILDDGLEIEVERIKGSAQGDVKVYLPNDAVRDDAWLQKKLNYISKK
    USA300_FPR3757  EPRLGNQYGGKLVLILDDGLEIEVERIKGSAQGDVKVYLPNGAVRDDAWLQKKLNYISKK
                    *****************************************.******************

    COL             TYQGIFSFDVLGLQDIHRNLNEKQLQDYLLQAGALGSTEFTSMREVINRKKDELYKKSGK
    N315            TYQGIFSFDVLGLQDIHRNLNEKQLQDYLLQAGALGSTEFTSMREVINRKKDELYKKSGK
    NCTC8325        TYQGIFSFDVLGLQDIHRNLNEKQLQDYLLQAGALGSTEFTSMREVINRKKDELYKKSGK
    Newman          TYQGIFSFDVLGLQDIHRNLNEKQLQDYLLQAGALGSTEFTSMREVINRKKDELYKKSGK
    USA300_FPR3757  TYQGIFSFDVLGLQDIHRNLNEKQLQDYLLQAGALGSTEFTSMREVINRKKDELYKKSGK
                    ************************************************************

    COL             NPIINQQIEQLKQLESQIREEEAKLETYHRLVDDRDKSSRRLENLKHNLNQLSKMHEEKQ
    N315            NPIINQQIEQLKQLESQIREEEAKLETYHRLVDDRDKSSRRLENLKHNLNQLSKMHEEKQ
    NCTC8325        NPIINQQIEQLKQLESQIREEEAKLETYHRLVDDRDKSSRRLENLKHNLNQLSKMHEEKQ
    Newman          NPIINQQIEQLKQLESQIREEEAKLETYHRLVDDRDKSSRRLENLKHNLNQLSKMHEEKQ
    USA300_FPR3757  NPIINQQIEQLKQLESQIREEEAKLETYHRLVDDRDKSSRRLENLKHNLNQLSKMHEEKQ
                    ************************************************************

    COL             KEVALHDHSQEWKSLEQQLNIEPITFPEKGVDRYEKARAHKQSLERDIGLRNERLAQLKE
    N315            KEVALHDHSQEWKSLEQQLNIEPITFPEKGVDRYEKARAHKQSLERDIGLRNERLAQLKE
    NCTC8325        KEVALHDHSQEWKSLEQQLNIEPITFPEKGVDRYEKARAHKQSLERDIGLRNERLAQLKE
    Newman          KEVALHDHSQEWKSLEQQLNIEPITFPEKGVDRYEKARAHKQSLERDIGLRNERLAQLKE
    USA300_FPR3757  KEVALHDHSQEWKSLEQQLNIEPITFPEKGVDRYEKARAHKQSLERDIGLRNERLAQLKE
                    ************************************************************

    COL             EATQLEPVKQSDIDAFISLNQQENEIKNKEFELTAIEKDIANKQRDKDELQSNIGWSETH
    N315            EATQLEPVKQSDIDAFISLNQQENEIKNKEFELTAIEKDIANKQRDKDELQANIGWSETH
    NCTC8325        EATQLEPVKQSDIDAFISLNQQENEIKNKEFELTAIEKDIANKQRDKDELQSNIGWSETH
    Newman          EATQLEPVKQSDIDAFISLNQQENEIKNKEFELTAIEKDIANKQRDKDELQSNIGWSETH
    USA300_FPR3757  EATQLEPVKQSDIDAFISLNQQENEIKNKEFELTAIEKDIANKQRDKDELQSNIGWSETH
                    ***************************************************:********

    COL             HDVDSSEAMKSYVSEQIKNKQEQAAYIKQLERSLEENKIEDNAVHSELDSVEEKIVPEET
    N315            HDVDSSEAMKSYVSEQIKNKQEQAAYIKQLERSLEENKIEDNAVHSELDSVEEKIVPEET
    NCTC8325        HDVDSSEAMKSYVSEQIKNKQEQAAYIKQLERSLEENKIEDNAVHSELDSVEEKIVPEET
    Newman          HDVDSSEAMKSYVSEQIKNKQEQAAYIKQLERSLEENKIEDNAVHSELDSVEEKIVPEET
    USA300_FPR3757  HDVDSSEAMKSYVSEQIKNKQEQAAYIKQLERSLEENKIEDNAVHSELDSVEEKIVPEET
                    ************************************************************

    COL             FEKKKEYSQQVIELNEKENLYSKLKERFEIEQQEKQKRQKLLRTTFILLTLVGIGLTAFS
    N315            FEKKKEYSQQVIELNEKENLYSKLKERFEIEQQEKQKRQKLLRTTFILLTLVGIGLTAFS
    NCTC8325        FEKKKEYSQQVIELNEKENLYSKLKERFEIEQQEKQKRQKLLRTTFILLTLVGIGLTAFS
    Newman          FEKKKEYSQQVIELNEKENLYSKLKERFEIEQQEKQKRQKLLRTTFILLTLVGIGLTAFS
    USA300_FPR3757  FEKKKEYSQQVIELNEKENLYSKLKERFEIEQQEKQKRQKLLRTTFILLTLVGIGLTAFS
                    ************************************************************

    COL             FISNNMLFGIIFAVLTLVFVIGIIMSKSKEVDYSEAITDEIEEIKAQLAILDENYDLDFD
    N315            FISNNMLFGIIFAVLTLVFVIGIIMSKSKEVDYSEAITDEIEEIKAQLAILDENYDLDFD
    NCTC8325        FISNNMLFGIIFAVLTLVFVIGIIMSKSKEVDYSEAITDEIEEIKAQLAILDENYDLDFD
    Newman          FISNNMLFGIIFAVLTLVFVIGIIMSKSKEVDYSEAITDEIEEIKAQLAILDENYDLDFD
    USA300_FPR3757  FISNNMLFGIIFAVLTLVFVIGIIMSKSKEVDYSEAITDEIEEIKAQLAILDENYDLDFD
                    ************************************************************

    COL             LDEQYRIRDHWQQALKNKDILEEKRQYIEGRLNDAKGRHDELQSTVENVKDELYLSSKIS
    N315            LDEQYRIRDHWQQALKNKDILEEKRQYIEGRLNDAKGRHDELQSTVENVKDELYLSSKIS
    NCTC8325        LDEQYRIRDHWQQALKNKDILEEKRQYIEGRLNDAKGRHDELQSTVENVKDELYLSSKIS
    Newman          LDEQYRIRDHWQQALKNKDILEEKRQYIEGRLNDAKGRHDELQSTVENVKDELYLSSKIS
    USA300_FPR3757  LDEQYRIRDHWQQALKNKDILEEKRQYIEGRLNDAKGRHDELQSTVENVKDELYLSSKIS
                    ************************************************************

    COL             NDLIVDSISTMANIKALDQHISDLNQQRQQLVQELDTFYNHAEAVTKSQFVYFNKLSLFH
    N315            NDLIVDSISTMANIKALDQHISDLNQQRQQLVQELDTFYNHAEAVTKSQFVYFNKLSLFH
    NCTC8325        NDLIVDSISTMANIKALDQHISDLNQQRQQLVQELDTFYNHAEAVTKSQFVYFNKLSLFH
    Newman          NDLIVDSISTMANIKALDQHISDLNQQRQQLVQELDTFYNHAEAVTKSQFVYFNKLSLFH
    USA300_FPR3757  NDLIVDSISTMANIKALDQHISDLNQQRQQLVQELDTFYNHAEAVTKSQFVYFNKLSLFH
                    ************************************************************

    COL             DVQQWLKSAEDTNEKWRINAENTKLVTNELNHLNAQLEENNKEITALFDFINVGTEEDFY
    N315            DVQQWLKSAEDTNEKWRINAENTKLVTNELNHLNAQLEENNKEITALFDFINVGTEEDFY
    NCTC8325        DVQQWLKSAEDTNEKWRINAENTKLVTNELNHLNAQLEENNKEITALFDFINVGTEEDFY
    Newman          DVQQWLKSAEDTNEKWRINAENTKLVTNELNHLNAQLEENNKEITALFDFINVGTEEDFY
    USA300_FPR3757  DVQQWLKSAEDTNEKWRINAENTKLVTNELNHLNAQLEENNKEITALFDFINVGTEEDFY
                    ************************************************************

    COL             QHHEDYQTYTSNLSRFNDLTKYLENQNYSYELSSSLSEKTTAQLEEEDHLLATQVDEYNE
    N315            QHHEDYQTYTSNLSRFNDLTKYLENQNYSYELSSSLSEKTTAQLEEEDHLLATQVDEYNE
    NCTC8325        QHHEDYQTYTSNLSRFNDLTKYLENQNYSYELSSSLSEKTTAQLEEEDHLLATQVDEYNE
    Newman          QHHEDYQTYTSNLSRFNDLTKYLENQNYSYELSSSLSEKTTAQLEEEDHLLATQVDEYNE
    USA300_FPR3757  QHHEDYQTYTSNLSRFNDLTKYLENQNYSYELSSSLSEKTTAQLEEEDHLLATQVDEYNE
                    ************************************************************

    COL             QYLEMQAQVSDLSAQINHMETDTTLANLRHEYHSLKNQLNDIAKDWASLSYLQSLVDEHI
    N315            QYLEMQAQVSDLSAQINHMETDTTLANLRHEYHSLKNQLNDIAKDWASLSYLQSLVDEHI
    NCTC8325        QYLEMQAQVSDLSAQINHMETDTTLANLRHEYHSLKNQLNDIAKDWASLSYLQSLVDEHI
    Newman          QYLEMQAQVSDLSAQINHMETDTTLANLRHEYHSLKNQLNDIAKDWASLSYLQSLVDEHI
    USA300_FPR3757  QYLEMQAQVSDLSAQINHMETDTTLANLRHEYHSLKNQLNDIAKDWASLSYLQSLVDEHI
                    ************************************************************

    COL             KQIKDKRLPQVINEAVEILKHLTDGRYTMINYNEDSITVKHVNGQLYDPVELSQSTKELL
    N315            KQIKDKRLPQVINEAVEILKHLTDGRYTMINYNEDSITVKHVNGQLYDPVELSQSTKELL
    NCTC8325        KQIKDKRLPQVINEAVEILKHLTDGRYTMINYNEDSITVKHVNGQLYDPVELSQSTKELL
    Newman          KQIKDKRLPQVINEAVEILKHLTDGRYTMINYNEDSITVKHVNGQLYDPVELSQSTKELL
    USA300_FPR3757  KQIKDKRLPQVINEAVEILKHLTDGRYTMINYNEDSITVKHVNGQLYDPVELSQSTKELL
                    ************************************************************

    COL             YVALRISLIKVLRPYYPFPLIVDDAFVHFDKKRTEKMLNYLRSLSEHYQVLYFTCVKDNI
    N315            YVALRISLIKVLRPYYPFPLIVDDAFVHFDKKRTEKMLNYLRSLSEHYQVLYFTCVKDNI
    NCTC8325        YVALRISLIKVLRPYYPFPLIVDDAFVHFDKKRTEKMLNYLRSLSEHYQVLYFTCVKDNI
    Newman          YVALRISLIKVLRPYYPFPLIVDDAFVHFDKKRTEKMLNYLRSLSEHYQVLYFTCVKDNI
    USA300_FPR3757  YVALRISLIKVLRPYYPFPLIVDDAFVHFDKKRTEKMLNYLRSLSEHYQVLYFTCVKDNI
                    ************************************************************

    COL             VPSKEVITLNKIEEGGKR
    N315            VPSKEVITLNKIEEGGKR
    NCTC8325        VPSKEVITLNKIEEGGKR
    Newman          VPSKEVITLNKIEEGGKR
    USA300_FPR3757  VPSKEVITLNKIEEGGKR
                    ******************