Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004776000
  • symbol?:
  • description?: putative transcriptional regulator

      descriptions from strain specific annotations:

    • putative transcriptional regulator
    • protein BLi01058/
    • conserved cytoplasmic protein
  • strand?: -
  • coordinates?: 4987002..4987346
  • synteny block?: BlockID0037080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1801
    08BA02176:
    C248_1887
    11819-97:
    MS7_1850
    71193:
    ST398NM01_1911
    ECT-R 2:
    ECTR2_1687
    ED133:
    SAOV_1842
    ED98:
    SAAV_1864
    HO 5096 0412:
    SAEMRSA15_17500
    JH1:
    SaurJH1_1932
    JH9:
    SaurJH9_1898
    JKD6008:
    SAA6008_01802
    JKD6159:
    SAA6159_01773
    LGA251:
    SARLGA251_17280
    M013:
    M013TW_1851
    MRSA252:
    SAR1936
    MSHR1132:
    SAMSHR1132_16910
    MSSA476:
    SAS1766
    Mu3:
    SAHV_1830
    Mu50:
    SAV1845
    MW2:
    MW1786
    RF122:
    SAB1778c
    ST398:
    SAPIG1911
    T0131:
    SAT0131_01965
    TCH60:
    HMPREF0772_11299
    TW20:
    SATW20_18390
    USA300_TCH1516:
    USA300HOU_1838
    VC40:
    SAVC_08465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE
    N315            MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE
    NCTC8325        MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE
    Newman          MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE
    USA300_FPR3757  MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE
                    ************************************************************

    COL             EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
    N315            EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
    NCTC8325        EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
    Newman          EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
    USA300_FPR3757  EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
                    ******************************************************