From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004777000
  • symbol?:
  • description?: DUF445 domain-containing protein

      descriptions from strain specific annotations:

    • DUF445 domain-containing protein
    • membrane associated protein
    • membrane protein
  • strand?: -
  • coordinates?: 4987424..4988548
  • synteny block?: BlockID0037090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1802
    08BA02176:
    C248_1888
    11819-97:
    MS7_1851
    71193:
    ST398NM01_1912
    ECT-R 2:
    ECTR2_1688
    ED133:
    SAOV_1843
    ED98:
    SAAV_1865
    HO 5096 0412:
    SAEMRSA15_17510
    JH1:
    SaurJH1_1933
    JH9:
    SaurJH9_1899
    JKD6008:
    SAA6008_01803
    JKD6159:
    SAA6159_01774
    LGA251:
    SARLGA251_17290
    M013:
    M013TW_1852
    MRSA252:
    SAR1937
    MSHR1132:
    SAMSHR1132_16920
    MSSA476:
    SAS1767
    Mu3:
    SAHV_1831
    Mu50:
    SAV1846
    MW2:
    MW1787
    RF122:
    SAB1779c
    ST398:
    SAPIG1912
    T0131:
    SAT0131_01966 (nrdF)
    TCH60:
    HMPREF0772_11298
    TW20:
    SATW20_18400
    USA300_TCH1516:
    USA300HOU_1839
    VC40:
    SAVC_08470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK
    N315            MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK
    NCTC8325        MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK
    Newman          MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK
    USA300_FPR3757  MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK
                    ************************************************************

    COL             IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV
    N315            IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV
    NCTC8325        IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV
    Newman          IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV
    USA300_FPR3757  IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV
                    ************************************************************

    COL             LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK
    N315            LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK
    NCTC8325        LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK
    Newman          LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK
    USA300_FPR3757  LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK
                    *************************************:**********************

    COL             GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE
    N315            GTQDINDMLDTFFHEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE
    NCTC8325        GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE
    Newman          GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE
    USA300_FPR3757  GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE
                    *************:**********************************************

    COL             YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL
    N315            YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASNQANKPVVTLMPQFVDYLEGQLSSKL
    NCTC8325        YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL
    Newman          YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL
    USA300_FPR3757  YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL
                    **********************************:*************************

    COL             ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG
    N315            ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG
    NCTC8325        ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG
    Newman          ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG
    USA300_FPR3757  ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG
                    ************************************************************

    COL             GIIGFFQGLVAIFV
    N315            GIIGFFQGLVAIFV
    NCTC8325        GIIGFFQGLVAIFV
    Newman          GIIGFFQGLVAIFV
    USA300_FPR3757  GIIGFFQGLVAIFV
                    **************