From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004782000
  • symbol?: airS
  • description?: two-component sensor histidine kinase-like protein

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase-like protein
    • GAF sensor signal transduction histidine kinase
    • histidine kinase dimerisation and phosphoacceptor region
    • sensor histidine kinase, putative
    • Nitrate/nitrite sensor protein
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • putative sensor histidine kinase
    • histidine kinase protein
    • two-component response regulator sensor protein, histidine kinase
    • Sensor histidine kinase
    • two-component response system sensor histidine kinase
    • putative histidine kinase
    • Two-component sensor protein
  • strand?: -
  • coordinates?: 4991719..4992831
  • synteny block?: BlockID0037140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1805
    08BA02176:
    C248_1892
    11819-97:
    MS7_1854
    71193:
    ST398NM01_1915
    ECT-R 2:
    ECTR2_1691
    ED133:
    SAOV_1846
    ED98:
    SAAV_1868
    HO 5096 0412:
    SAEMRSA15_17540
    JH1:
    SaurJH1_1937
    JH9:
    SaurJH9_1903
    JKD6008:
    SAA6008_01806 (yhcS)
    JKD6159:
    SAA6159_01777 (yhcS)
    LGA251:
    SARLGA251_17320 (yhcS)
    M013:
    M013TW_1855
    MRSA252:
    SAR1940
    MSHR1132:
    SAMSHR1132_16950
    MSSA476:
    SAS1770
    Mu3:
    SAHV_1834 (yhcS)
    Mu50:
    SAV1849
    MW2:
    MW1790
    RF122:
    SAB1782c
    ST398:
    SAPIG1915
    T0131:
    SAT0131_01969
    TCH60:
    HMPREF0772_11295
    TW20:
    SATW20_18430 (yhcS)
    USA300_TCH1516:
    USA300HOU_1843
    VC40:
    SAVC_08485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQRTRLALLKEIAEFLNEETEMYSMTQGALKYLIEGSNFTTGWIFFINSVGEHELVSHV
    N315            MEQRTRLALLKEIAEFLNEETEMYSMTQGALKYLIEGSNFTTGWIFFINSVGEHELVSHV
    NCTC8325        MEQRTRLALLKEIAEFLNEETEMYSMTQGALKYLIEGSNFTTGWIFFINSVGEHELVSHV
    Newman          MEQRTRLALLKEIAEFLNEETEMYSMTQGALKYLIEGSNFTTGWIFFINSVGEHELVSHV
    USA300_FPR3757  MEQRTRLALLKEIAEFLNEETEMYSMTQGALKYLIEGSNFTTGWIFFINSVGEHELVSHV
                    ************************************************************

    COL             ALPQSLTADHCHYIKDGSCWCVKAFNQRRLMKASNIVNCSRINLASKAFPSQNDNITHHA
    N315            ALPQSLTADHCHYIKDGSCWCVKAFNQRRLMKASNIVNCSRINLASKAFPSQNDNITHHA
    NCTC8325        ALPQSLTADHCHYIKDGSCWCVKAFNQRRLMKASNIVNCSRINLASKAFPSQNDNITHHA
    Newman          ALPQSLTADHCHYIKDGSCWCVKAFNQRRLMKASNIVNCSRINLASKAFPSQNDNITHHA
    USA300_FPR3757  ALPQSLTADHCHYIKDGSCWCVKAFNQRRLMKASNIVNCSRINLASKAFPSQNDNITHHA
                    ************************************************************

    COL             TVPLKSGQEQFGILNVASPNTEIYSDEDLELLESVAFQLGSAIKRIYLTDREKEAAKINE
    N315            TVPLKSGQEQFGILNVASPNTEIYSDEDLELLESVAFQLGSAIKRIYLTDREKEAAKINE
    NCTC8325        TVPLKSGQEQFGILNVASPNTEIYSDEDLELLESVAFQLGSAIKRIYLTDREKEAAKINE
    Newman          TVPLKSGQEQFGILNVASPNTEIYSDEDLELLESVAFQLGSAIKRIYLTDREKEAAKINE
    USA300_FPR3757  TVPLKSGQEQFGILNVASPNTEIYSDEDLELLESVAFQLGSAIKRIYLTDREKEAAKINE
                    ************************************************************

    COL             RNRLARDLHDSVNQMLFSVKLTAHAAYGMSNESIAKQAFKTIEETSQNAVNEMRALIWQL
    N315            RNRLARDLHDSVNQMLFSVKLTAHAAYGMSNESIAKQAFKTIEKTSQNAVNEMRALIWQL
    NCTC8325        RNRLARDLHDSVNQMLFSVKLTAHAAYGMSNESIAKQAFKTIEETSQNAVNEMRALIWQL
    Newman          RNRLARDLHDSVNQMLFSVKLTAHAAYGMSNESIAKQAFKTIEETSQNAVNEMRALIWQL
    USA300_FPR3757  RNRLARDLHDSVNQMLFSVKLTAHAAYGMSNESIAKQAFKTIEETSQNAVNEMRALIWQL
                    *******************************************:****************

    COL             KPVGLEQGLIHALTAYSKLMHIQLNVNVEGLIDLSNEIEENIYRALQECINNVKKHADTN
    N315            KPVGLEQGLIHALTAYSKLMHIQLNVNVEGLIDLSNEIEENIYRALQECINNVKKHADTN
    NCTC8325        KPVGLEQGLIHALTAYSKLMHIQLNVNVEGLIDLSNEIEENIYRALQECINNVKKHADTN
    Newman          KPVGLEQGLIHALTAYSKLMHIQLNVNVEGLIDLSNEIEENIYRALQECINNVKKHADTN
    USA300_FPR3757  KPVGLEQGLIHALTAYSKLMHIQLNVNVEGLIDLSNEIEENIYRALQECINNVKKHADTN
                    ************************************************************

    COL             KMDLTLKQMNDILYIDVIDYGQGFEIDNVQIASSHGINNIKQRVKLLRGKVTFHSQPTKG
    N315            KMDLTLKQMNDILYIDVIDYGQGFEIDNVQIASSHGINNIKQRVKLLRGKVTFHSQPTKG
    NCTC8325        KMDLTLKQMNDILYIDVIDYGQGFEIDNVQIASSHGINNIKQRVKLLRGKVTFHSQPTKG
    Newman          KMDLTLKQMNDILYIDVIDYGQGFEIDNVQIASSHGINNIKQRVKLLRGKVTFHSQPTKG
    USA300_FPR3757  KMDLTLKQMNDILYIDVIDYGQGFEIDNVQIASSHGINNIKQRVKLLRGKVTFHSQPTKG
                    ************************************************************

    COL             TQIQFTIPIK
    N315            TQIQFTIPIK
    NCTC8325        TQIQFTIPIK
    Newman          TQIQFTIPIK
    USA300_FPR3757  TQIQFTIPIK
                    **********