Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004785000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 4995850..4996267
  • synteny block?: BlockID0037170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1808
    08BA02176:
    C248_1895
    11819-97:
    MS7_1857
    71193:
    ST398NM01_1918
    ECT-R 2:
    ECTR2_1694
    ED133:
    SAOV_1849
    ED98:
    SAAV_1871
    HO 5096 0412:
    SAEMRSA15_17570
    JH1:
    SaurJH1_1940
    JH9:
    SaurJH9_1906
    JKD6008:
    SAA6008_01809
    JKD6159:
    SAA6159_01780
    LGA251:
    SARLGA251_17350
    M013:
    M013TW_1858
    MRSA252:
    SAR1943
    MSHR1132:
    SAMSHR1132_16980
    MSSA476:
    SAS1773
    Mu3:
    SAHV_1837
    Mu50:
    SAV1852
    MW2:
    MW1793
    RF122:
    SAB1785c
    ST398:
    SAPIG1918
    T0131:
    SAT0131_01972
    TCH60:
    HMPREF0772_11292
    TW20:
    SATW20_18460
    USA300_TCH1516:
    USA300HOU_1846
    VC40:
    SAVC_08505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLGKYWIQLLIATVIISLISIKAFPLAIGALYLPVIFKVIKLQLNLSKGLIDDVNAQTFI
    N315            MLGKYWIQLLIATVIISLISIKAFPLAIGALYLPVIFKVIKLQLNLSKGLIDDVNAQTFI
    NCTC8325        MLGKYWIQLLIATVIISLISIKAFPLAIGALYLPVIFKVIKLQLNLSKGLIDDVNAQTFI
    Newman          MLGKYWIQLLIATVIISLISIKAFPLAIGALYLPVIFKVIKLQLNLSKGLIDDVNAQTFI
    USA300_FPR3757  MLGKYWIQLLIATVIISLISIKAFPLAIGALYLPVIFKVIKLQLNLSKGLIDDVNAQTFI
                    ************************************************************

    COL             KSNQSGIVISVICCLLITAILYYTLDGFYASLTGVLGTLVALNPYTTIVSAVLYILTAIA
    N315            KSNQSGIVISVICCLLITGILYYTLDGFYASLTGVLGTLVALNPYTTIVSAVLYILTAIA
    NCTC8325        KSNQSGIVISVICCLLITAILYYTLDGFYASLTGVLGTLVALNPYTTIVSAVLYILTAIA
    Newman          KSNQSGIVISVICCLLITAILYYTLDGFYASLTGVLGTLVALNPYTTIVSAVLYILTAIA
    USA300_FPR3757  KSNQSGIVISVICCLLITAILYYTLDGFYASLTGVLGTLVALNPYTTIVSAVLYILTAIA
                    ******************.*****************************************

    COL             TVEATKTKYRN
    N315            TVEATKTKYRN
    NCTC8325        TVEATKTKYRN
    Newman          TVEATKTKYRN
    USA300_FPR3757  TVEATKTKYRN
                    ***********