From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004795000
  • symbol?:
  • description?: regulatory protein

      descriptions from strain specific annotations:

    • regulatory protein
    • phosphotransferase system, EIIC
    • PTS system transporter subunit IIC
    • PTS system, IIC component
    • phosphotransferase system, EIIC family protein
    • phosphotransferase system EIIC domain-containing protein
    • toxin regulatory protein
    • membrane spanning protein
    • membrane protein
  • strand?: -
  • coordinates?: 5002801..5003862
  • synteny block?: BlockID0037270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1815 (pfoS/R)
    08BA02176:
    C248_1903
    11819-97:
    MS7_1864
    71193:
    ST398NM01_1925
    ECT-R 2:
    ECTR2_1701
    ED133:
    SAOV_1856
    ED98:
    SAAV_1878
    HO 5096 0412:
    SAEMRSA15_17640
    JH1:
    SaurJH1_1947
    JH9:
    SaurJH9_1913
    JKD6008:
    SAA6008_01816
    JKD6159:
    SAA6159_01788
    LGA251:
    SARLGA251_17420
    M013:
    M013TW_1865
    MRSA252:
    SAR1950
    MSHR1132:
    SAMSHR1132_17050
    MSSA476:
    SAS1782
    Mu3:
    SAHV_1844
    Mu50:
    SAV1859
    MW2:
    MW1800
    RF122:
    SAB1793c
    ST398:
    SAPIG1925
    T0131:
    SAT0131_01979
    TCH60:
    HMPREF0772_11285
    TW20:
    SATW20_18530
    USA300_TCH1516:
    USA300HOU_1854
    VC40:
    SAVC_08545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNANNADNKQFFSKILNSIGAGVVIALVPNALLGEVLKIFKSGNEILELTYQLVILIQS
    N315            MSNANNADNKQFFSKILNSIGAGVVIALVPNALLGEVLKIFKSGNEILELTYQLVILIQL
    NCTC8325        MSNANNADNKQFFSKILNSIGAGVVIALVPNALLGEVLKIFKSGNEILELTYQLVILIQS
    Newman          MSNANNADNKQFFSKILNSIGAGVVIALVPNALLGEVLKIFKSGNEILELTYQLVILIQS
    USA300_FPR3757  MSNANNADNKQFFSKILNSIGAGVVIALVPNALLGEVLKIFKSGNEILELTYQLVILIQS
                    *********************************************************** 

    COL             FMAFIIGVLAAHQFKFNGAGAAIVGTSAMIGSGAVVYSNNSFMLKGIGDIINTSLVVIIA
    N315            FMAFIIGVLAAHQFKFNGAGAAIVGTSAMIGSGAVVYSNNSFMLKGIGDIINTSLVVIIA
    NCTC8325        FMAFIIGVLAAHQFKFNGAGAAIVGTSAMIGSGAVVYSNNSFMLKGIGDIINTSLVVIIA
    Newman          FMAFIIGVLAAHQFKFNGAGAAIVGTSAMIGSGAVVYSNNSFMLKGIGDIINTSLVVIIA
    USA300_FPR3757  FMAFIIGVLAAHQFKFNGAGAAIVGTSAMIGSGAVVYSNNSFMLKGIGDIINTSLVVIIA
                    ************************************************************

    COL             CLIYMVLQNKLGSFELIILPVLVPIVSGGIGLITLPYIRKITQAIGNVIHSFTDLNPLLM
    N315            CLIYMVLQNKLGSFELIILPVLVPIVSGGIGLITLPYIRKITQAIGNVIHSFTDLNPLLM
    NCTC8325        CLIYMVLQNKLGSFELIILPVLVPIVSGGIGLITLPYIRKITQAIGNVIHSFTDLNPLLM
    Newman          CLIYMVLQNKLGSFELIILPVLVPIVSGGIGLITLPYIRKITQAIGNVIHSFTDLNPLLM
    USA300_FPR3757  CLIYMVLQNKLGSFELIILPVLVPIVSGGIGLITLPYIRKITQAIGNVIHSFTDLNPLLM
                    ************************************************************

    COL             SILISVAFSLLMVTPISLVAIATAISLNGLGSGAANLGIVAACVTFLFGSLRVNSIGVNA
    N315            SILISVAFSLLMVTPISLVAIATAISLNGLGSGAANLGIVAACVTFLFGSLRVNSIGVNA
    NCTC8325        SILISVAFSLLMVTPISLVAIATAISLNGLGSGAANLGIVAACVTFLFGSLRVNSIGVNA
    Newman          SILISVAFSLLMVTPISLVAIATAISLNGLGSGAANLGIVAACVTFLFGSLRVNSIGVNA
    USA300_FPR3757  SILISVAFSLLMVTPISLVAIATAISLNGLGSGAANLGIVAACVTFLFGSLRVNSIGVNA
                    ************************************************************

    COL             VLLIGAAKMMIPVYLKNLIISIPLTINGIITGIIAYVLQVKGTPLSAGFGYTGLVGPINA
    N315            VLLIGAAKMMIPVYLKNLIISIPLTINGIITGIIAYVLQVKGTPLSAGFGYTGLVGPINA
    NCTC8325        VLLIGAAKMMIPVYLKNLIISIPLTINGIITGIIAYVLQVKGTPLSAGFGYTGLVGPINA
    Newman          VLLIGAAKMMIPVYLKNLIISIPLTINGIITGIIAYVLQVKGTPLSAGFGYTGLVGPINA
    USA300_FPR3757  VLLIGAAKMMIPVYLKNLIISIPLTINGIITGIIAYVLQVKGTPLSAGFGYTGLVGPINA
                    ************************************************************

    COL             FNRMSGDPTMNIILLALGYFVIPFVSAFIVHELCKKFIPIYSNDIYKFEVPKQ
    N315            FNRMSGDPTMNIILLALGYFVIPFVSAFIVHELCKKFIPIYSNDIYKFEVPKQ
    NCTC8325        FNRMSGDPTMNIILLALGYFVIPFVSAFIVHELCKKFIPIYSNDIYKFEVPKQ
    Newman          FNRMSGDPTMNIILLALGYFVIPFVSAFIVHELCKKFIPIYSNDIYKFEVPKQ
    USA300_FPR3757  FNRMSGDPTMNIILLALGYFVIPFVSAFIVHELCKKFIPIYSNDIYKFEVPKQ
                    *****************************************************