From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004796000
  • symbol?: tnp3
  • description?: ISL3 family transposase IS1181

      descriptions from strain specific annotations:

    • ISL3 family transposase IS1181
    • IS1181 transposase
    • transposase
    • ISL3 family transposase
    • transposase for IS1181
    • IS1181, transposase
    • transposase, IS204/IS1001/IS1096/IS1165 family protein
    • transposase family protein
    • Transposase for Insertion sequence IS1181
    • transposase IS204/IS1001/IS1096/IS1165 family protein
  • strand?: +
  • coordinates?: 5004434..5005672
  • synteny block?: BlockID0037280
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1677 (tnp)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1816
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1702
    ED133:
    ED98:
    SAAV_1879
    HO 5096 0412:
    JH1:
    SaurJH1_1948
    JH9:
    SaurJH9_1914
    JKD6008:
    SAA6008_01817
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_1845 (tnp)
    Mu50:
    SAV1860 (tnp)
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_01980 (fbp)
    TCH60:
    TW20:
    SATW20_18540
    USA300_TCH1516:
    USA300HOU_1855
    VC40:
    SAVC_08550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYC
    N315            ------------MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYC
    Newman          ------------MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYC
    USA300_FPR3757  MTKPKLKETSAPMCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYC
                                ************************************************

    COL             CGVKNEGQIHKHGKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFI
    N315            CGVKNEGQIHKHGKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFI
    Newman          CGVKNEGQIHKHGKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFI
    USA300_FPR3757  CGVKNEGQIHKHGKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFI
                    ************************************************************

    COL             SRCVTQKVIEEATKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEF
    N315            SRCVTQKVIEEATKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEF
    Newman          SRCVTQKVIEEATKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEF
    USA300_FPR3757  SRCVTQKVIEEATKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEF
                    ************************************************************

    COL             KSVKNVTGSMSFIFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPY
    N315            KSVKNVTGSMSFIFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPY
    Newman          KSVKNVTGSMSFIFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPY
    USA300_FPR3757  KSVKNVTGSMSFIFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPY
                    ************************************************************

    COL             VRLFRDLFPNAAIIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMD
    N315            VRLFRDLFPNAAIIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPNYTIFKNNWKVLLMD
    Newman          VRLFRDLFPNAAIIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMD
    USA300_FPR3757  VRLFRDLFPNAAIIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMD
                    *********************************************:**************

    COL             TSKTIFSKYRWNKSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINR
    N315            TSKTIFSKYRWNKSFKAYKRSSDIVEFMLSKDDILRRSYELVQGLRKDLRLCNWPKFINR
    Newman          TSKTIFSKYRWNKSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINR
    USA300_FPR3757  TSKTIFSKYRWNKSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINR
                    ************************************:***********************

    COL             LNSVSKKSVSKGVWKAVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIKRISFGYRN
    N315            LNSVSKKSVSKGVWKVVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIKRISFGYRN
    Newman          LNSVSKKSVSKGVWKAVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIKRISFGYRN
    USA300_FPR3757  LNSVSKKSVSKGVWKAVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIKRISFGYRN
                    ***************.********************************************

    COL             FNNFKARIMMIFSLYKGEKKKTTKPNNGLAA
    N315            FNNFKARIMMIFSLYKGEKKKTTKPNNGLAA
    Newman          FNNFKARIMMIFSLYKGEKKKTTKPNNGLAA
    USA300_FPR3757  FNNFKARIMMIFSLYKGEKKKTTKPNNGLAA
                    *******************************