From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004842000
  • symbol?:
  • description?: D-3-phosphoglycerate dehydrogenase

      descriptions from strain specific annotations:

    • D-3-phosphoglycerate dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase family protein
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
    • Phosphoglycerate dehydrogenase-like dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein
    • phosphoglycerate dehydrogenase-related dehydrogenase
  • strand?: -
  • coordinates?: 5049648..5050598
  • synteny block?: BlockID0037720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1818
    08BA02176:
    C248_1933
    11819-97:
    MS7_1897
    71193:
    ST398NM01_1955
    ECT-R 2:
    ECTR2_1733
    ED133:
    SAOV_1889
    ED98:
    SAAV_1912
    HO 5096 0412:
    SAEMRSA15_17690
    JH1:
    SaurJH1_1950
    JH9:
    SaurJH9_1916
    JKD6008:
    SAA6008_01819
    JKD6159:
    SAA6159_01793
    LGA251:
    SARLGA251_17440
    M013:
    M013TW_1896
    MRSA252:
    SAR1952
    MSHR1132:
    SAMSHR1132_17070
    MSSA476:
    SAS1784
    Mu3:
    SAHV_1847
    Mu50:
    SAV1862
    MW2:
    MW1802
    RF122:
    SAB1795c
    ST398:
    SAPIG1955
    T0131:
    SAT0131_01984 (llm)
    TCH60:
    HMPREF0772_11282
    TW20:
    SATW20_18560
    USA300_TCH1516:
    USA300HOU_1857
    VC40:
    SAVC_08565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLRRC
    N315            MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLQRC
    NCTC8325        MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLRRC
    Newman          MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLRRC
    USA300_FPR3757  MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLRRC
                    *********************************************************:**

    COL             PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
    N315            PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
    NCTC8325        PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
    Newman          PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
    USA300_FPR3757  PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
                    ************************************************************

    COL             QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
    N315            QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
    NCTC8325        QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
    Newman          QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
    USA300_FPR3757  QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
                    ************************************************************

    COL             TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
    N315            TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
    NCTC8325        TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
    Newman          TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
    USA300_FPR3757  TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
                    ************************************************************

    COL             LKSKVIRHAYLDVFENEPLKPNHELYELDNVTITAHITGNDYEAKYDLLDIFKNNLVNFL
    N315            LKSKVIRHAYLDVFENEPLKPNHELYELENVTITAHITGNDYEAKYDLLDIFKNNLVNFL
    NCTC8325        LKSKVIRHAYLDVFENEPLKPNHELYELDNVTITAHITGNDYEAKYDLLDIFKNNLVNFL
    Newman          LKSKVIRHAYLDVFENEPLKPNHELYELDNVTITAHITGNDYEAKYDLLDIFKNNLVNFL
    USA300_FPR3757  LKSKVIRHAYLDVFENEPLKPNHELYELDNVTITAHITGNDYEAKYDLLDIFKNNLVNFL
                    ****************************:*******************************

    COL             NKNGIIENEVDAKKGY
    N315            NKNGLIENEVDAKKGY
    NCTC8325        NKNGLIENEVDAKKGY
    Newman          NKNGLIENEVDAKKGY
    USA300_FPR3757  NKNGLIENEVDAKKGY
                    ****:***********