From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004847000
  • symbol?:
  • description?: multidrug ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • multidrug ABC transporter ATP-binding protein
    • toxin exporting ABC transporter permease/ATP-binding protein
    • ABC transporter ATP-binding/permease
    • ABC transporter ATP-binding protein
    • Lipid A export ATP-binding/permease protein MsbA
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter
    • ATP-binding ABC transporter
    • Lipid A export ATP-binding/permease MsbA
    • multidrug/protein/lipid ABC transporter family, ATP-binding and permease protein
    • putative multidrug export ATP-binding/permease
    • Putative multidrug export ATP-binding/permease protein
    • toxin exporting ABC transporter, permease
  • strand?: -
  • coordinates?: 5054038..5055213
  • synteny block?: BlockID0037770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1822
    08BA02176:
    C248_1937
    11819-97:
    MS7_1901
    71193:
    ST398NM01_1959
    ECT-R 2:
    ECTR2_1737
    ED133:
    SAOV_1893
    ED98:
    SAAV_1916
    HO 5096 0412:
    SAEMRSA15_17730
    JH1:
    SaurJH1_1954
    JH9:
    SaurJH9_1920
    JKD6008:
    SAA6008_01823 (msbA)
    JKD6159:
    SAA6159_01797 (msbA)
    LGA251:
    SARLGA251_17480
    M013:
    M013TW_1900
    MRSA252:
    SAR1956
    MSHR1132:
    SAMSHR1132_17110
    MSSA476:
    SAS1788
    Mu3:
    SAHV_1851
    Mu50:
    SAV1866
    MW2:
    MW1806
    RF122:
    SAB1799c
    ST398:
    SAPIG1959
    T0131:
    SAT0131_01988
    TCH60:
    HMPREF0772_11278
    TW20:
    SATW20_18600
    USA300_TCH1516:
    USA300HOU_1861
    VC40:
    SAVC_08585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
    N315            MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
    NCTC8325        MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
    Newman          MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
    USA300_FPR3757  MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT
                    ************************************************************

    COL             IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
    N315            IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
    NCTC8325        IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
    Newman          IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
    USA300_FPR3757  IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV
                    ************************************************************

    COL             ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
    N315            ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
    NCTC8325        ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
    Newman          ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
    USA300_FPR3757  ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV
                    ************************************************************

    COL             FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
    N315            FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
    NCTC8325        FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
    Newman          FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
    USA300_FPR3757  FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH
                    ************************************************************

    COL             TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
    N315            TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
    NCTC8325        TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
    Newman          TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
    USA300_FPR3757  TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS
                    ************************************************************

    COL             FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
    N315            FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
    NCTC8325        FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
    Newman          FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
    USA300_FPR3757  FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI
                    ************************************************************

    COL             NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
    N315            NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
    NCTC8325        NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
    Newman          NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
    USA300_FPR3757  NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV
                    ************************************************************

    COL             QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
    N315            QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
    NCTC8325        QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
    Newman          QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
    USA300_FPR3757  QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG
                    ************************************************************

    COL             GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
    N315            GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
    NCTC8325        GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
    Newman          GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
    USA300_FPR3757  GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT
                    ************************************************************

    COL             HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
    N315            HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
    NCTC8325        HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
    Newman          HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
    USA300_FPR3757  HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
                    **************************************