From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004849000
  • symbol?:
  • description?: protein LMOf2365_1711

      descriptions from strain specific annotations:

    • protein LMOf2365_1711
    • Cysteinyl-tRNA synthetase related protein
    • cysteinyl-tRNA synthetase-like protein
  • strand?: -
  • coordinates?: 5056068..5056610
  • synteny block?: BlockID0037790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1823
    08BA02176:
    C248_1938
    11819-97:
    MS7_1902
    71193:
    ST398NM01_1960
    ECT-R 2:
    ECTR2_1738
    ED133:
    SAOV_1894
    ED98:
    SAAV_1917
    HO 5096 0412:
    SAEMRSA15_17740
    JH1:
    SaurJH1_1955
    JH9:
    SaurJH9_1921
    JKD6008:
    SAA6008_01824
    JKD6159:
    SAA6159_01798
    LGA251:
    SARLGA251_17490
    M013:
    M013TW_1903
    MRSA252:
    SAR1957
    MSHR1132:
    SAMSHR1132_17120
    MSSA476:
    SAS1789
    Mu3:
    SAHV_1852
    Mu50:
    SAV1867
    MW2:
    MW1807
    RF122:
    SAB1800c
    ST398:
    SAPIG1960
    T0131:
    SAT0131_01989
    TCH60:
    HMPREF0772_11277
    TW20:
    SATW20_18610
    USA300_TCH1516:
    USA300HOU_1862
    VC40:
    SAVC_08590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWIT
    N315            MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWIT
    NCTC8325        MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWIT
    Newman          MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWIT
    USA300_FPR3757  MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWIT
                    ************************************************************

    COL             REPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYH
    N315            REPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYH
    NCTC8325        REPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYH
    Newman          REPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYH
    USA300_FPR3757  REPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYH
                    ************************************************************

    COL             LLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQY
    N315            LLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQY
    NCTC8325        LLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQY
    Newman          LLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQY
    USA300_FPR3757  LLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQY
                    ************************************************************