From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004855000
  • symbol?:
  • description?: Transcription regulator

      descriptions from strain specific annotations:

    • Transcription regulator
    • transcriptional regulator
    • conserved protein YfhH
  • strand?: -
  • coordinates?: 5061957..5062249
  • synteny block?: BlockID0037850
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1828
    08BA02176:
    C248_1944
    11819-97:
    MS7_1907
    71193:
    ST398NM01_1965
    ECT-R 2:
    ECTR2_1743
    ED133:
    ED98:
    SAAV_1922
    HO 5096 0412:
    SAEMRSA15_17790
    JH1:
    SaurJH1_1960
    JH9:
    SaurJH9_1926
    JKD6008:
    SAA6008_01829
    JKD6159:
    SAA6159_01803
    LGA251:
    SARLGA251_17540
    M013:
    M013TW_1908
    MRSA252:
    SAR1962
    MSHR1132:
    SAMSHR1132_17170
    MSSA476:
    SAS1794
    Mu3:
    SAHV_1857
    Mu50:
    SAV1872
    MW2:
    MW1812
    RF122:
    ST398:
    SAPIG1965
    T0131:
    SAT0131_01995 (prfB)
    TCH60:
    HMPREF0772_11272
    TW20:
    SATW20_18660
    USA300_TCH1516:
    USA300HOU_1867
    VC40:
    SAVC_08615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQKKLSEMSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIG
    N315            MEQKKLSEMSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIG
    NCTC8325        --------MSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIG
    Newman          MEQKKLSEMSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIG
    USA300_FPR3757  MEQKKLSEMSEPELRHEIQLYKEKMRKAEMNGILNEYDVYQSKVIVAESYLVDRKKIEIG
                            ****************************************************

    COL             KIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL
    N315            KIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL
    NCTC8325        KIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL
    Newman          KIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL
    USA300_FPR3757  KIYKLTDGSNQYFKVERLKGIFAWGFRFNSDEPEEGLPIALLQL
                    ********************************************