From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004856000
  • symbol?: recX
  • description?: recombination regulator RecX

      descriptions from strain specific annotations:

    • recombination regulator RecX
    • Regulatory protein recX
    • recX family protein
    • putative regulatory protein
  • strand?: -
  • coordinates?: 5062251..5062991
  • synteny block?: BlockID0037860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1931 (recX)
    N315:
    SA1690 (recX)
    NCTC8325:
    Newman:
    NWMN_1765 (recX)
    USA300_FPR3757:
    04-02981:
    SA2981_1829 (recX)
    08BA02176:
    C248_1945
    11819-97:
    MS7_1908 (recX)
    71193:
    ST398NM01_1966
    ECT-R 2:
    ECTR2_1744
    ED133:
    SAOV_1899
    ED98:
    SAAV_1923 (recX)
    HO 5096 0412:
    SAEMRSA15_17800
    JH1:
    SaurJH1_1961 (recX)
    JH9:
    SaurJH9_1927 (recX)
    JKD6008:
    SAA6008_01830 (recX)
    JKD6159:
    SAA6159_01804 (recX)
    LGA251:
    SARLGA251_17550
    M013:
    M013TW_1909
    MRSA252:
    SAR1963 (recX)
    MSHR1132:
    SAMSHR1132_17180
    MSSA476:
    SAS1795 (recX)
    Mu3:
    SAHV_1858 (recX)
    Mu50:
    SAV1873 (recX)
    MW2:
    MW1813 (recX)
    RF122:
    SAB1805c (recX)
    ST398:
    SAPIG1966
    T0131:
    SAT0131_01996
    TCH60:
    HMPREF0772_11271 (recX)
    TW20:
    SATW20_18670
    USA300_TCH1516:
    USA300HOU_1868 (recX)
    VC40:
    SAVC_08620 (recX)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKITKIEVQKKNKERFNLFLDEQFEMGIDIDTLVKFNLKKGQQLEAADMAEIQKYDHYR
    N315            MPKITKIEVQKKNKERFNLFLDEQFEMGIDIDTLVKFNLKKGQQLEAADMAEIQKYDHYR
    NCTC8325        MPKITKIEVQKKNKERFNLFLDEQFEMGIDIDTLVKFNLKKGQQLEAADMAEIQKYDHYR
    Newman          MPKITKIEVQKKNKERFNLFLDEQFEMGIDIDTLVKFNLKKGQQLEAADMAEIQKYDHYR
    USA300_FPR3757  MPKITKIEVQKKNKERFNLFLDEQFEMGIDIDTLVKFNLKKGQQLEAADMAEIQKYDHYR
                    ************************************************************

    COL             IGLNKAIQYLSYKKRTEKEVIQYLQKEEISEQAISEVIEYCYREKLIDHQDYAESLKNTM
    N315            IGLNKAIQYLSYKKRTEKEVIQYLQKEEISEQAISEVIEYCYREKLIDHQDYAESLKNTM
    NCTC8325        IGLNKAIQYLSYKKRTEKEVIQYLQKEEISEQAISEVIEYCYREKLIDHQDYAESLKNTM
    Newman          IGLNKAIQYLSYKKRTEKEVIQYLQKEEISEQAISEVIEYCYREKLIDHQDYAESLKNTM
    USA300_FPR3757  IGLNKAIQYLSYKKRTEKEVIQYLQKEEISEQAISEVIEYCYREKLIDHQDYAESLKNTM
                    ************************************************************

    COL             IRTTDKGPKIYQQKLYQLGIEPNIIEIFTELYREQQELDDIIQIAEKISKTKKGPQNKVK
    N315            IRTTDKGPKIYQQKLYQLGIEPNIIEMFTELYREQQELDDIIQIAEKISKTKKGPQNKVK
    NCTC8325        IRTTDKGPKIYQQKLYQLGIEPNIIEIFTELYREQQELDDIIQIAEKISKTKKGPQNKVK
    Newman          IRTTDKGPKIYQQKLYQLGIEPNIIEIFTELYREQQELDDIIQIAEKISKTKKGPQNKVK
    USA300_FPR3757  IRTTDKGPKIYQQKLYQLGIEPNIIEIFTELYREQQELDDIIQIAEKISKTKKGPQNKVK
                    **************************:*********************************

    COL             EKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISK
    N315            EKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISK
    NCTC8325        EKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISK
    Newman          EKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISK
    USA300_FPR3757  EKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQKLISK
                    ************************************************************

    COL             TIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
    N315            TIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
    NCTC8325        TIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
    Newman          TIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
    USA300_FPR3757  TIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
                    ********************************