From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004860000
  • symbol?:
  • description?: glutamine amidotransferase

      descriptions from strain specific annotations:

    • glutamine amidotransferase
    • ThiJ/PfpI family protein
    • C56 family endopeptidase PfpI
    • general stress protein 18
    • general stress protein GSP18
    • intracellular protease
    • intracellular protease YhbO
    • PfpI family intracellular peptidase
    • protease I
  • strand?: -
  • coordinates?: 5066342..5066872
  • synteny block?: BlockID0037890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1831
    08BA02176:
    C248_1947
    11819-97:
    MS7_1910 (yfkM)
    71193:
    ST398NM01_1968
    ECT-R 2:
    ECTR2_1746
    ED133:
    SAOV_1903
    ED98:
    SAAV_1925
    HO 5096 0412:
    SAEMRSA15_17820
    JH1:
    SaurJH1_1963
    JH9:
    SaurJH9_1929
    JKD6008:
    SAA6008_01832 (pfpI)
    JKD6159:
    SAA6159_01806 (pfpI)
    LGA251:
    SARLGA251_17570
    M013:
    M013TW_1911
    MRSA252:
    SAR1965
    MSHR1132:
    SAMSHR1132_17200
    MSSA476:
    SAS1797
    Mu3:
    SAHV_1860
    Mu50:
    SAV1875
    MW2:
    MW1815
    RF122:
    SAB1807c
    ST398:
    SAPIG1968
    T0131:
    SAT0131_01998
    TCH60:
    HMPREF0772_11269 (yhbO)
    TW20:
    SATW20_18690
    USA300_TCH1516:
    USA300HOU_1870
    VC40:
    SAVC_08630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEA
    N315            MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEA
    NCTC8325        MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEA
    Newman          MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEA
    USA300_FPR3757  MTKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEA
                    ************************************************************

    COL             KPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGR
    N315            KPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGR
    NCTC8325        KPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGR
    Newman          KPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGR
    USA300_FPR3757  KPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHGPQILIDTDDLKGR
                    ************************************************************

    COL             TLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ
    N315            TLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ
    NCTC8325        TLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ
    Newman          TLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ
    USA300_FPR3757  TLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQ
                    ***************************************************