From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004861000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5067007..5067168
  • synteny block?: BlockID0037900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1832
    08BA02176:
    C248_1948
    11819-97:
    MS7_1911
    71193:
    ST398NM01_1969
    ECT-R 2:
    ECTR2_1747
    ED133:
    SAOV_1904
    ED98:
    SAAV_1926
    HO 5096 0412:
    SAEMRSA15_17830
    JH1:
    SaurJH1_1964
    JH9:
    SaurJH9_1930
    JKD6008:
    SAA6008_01833
    JKD6159:
    SAA6159_01807
    LGA251:
    SARLGA251_17580
    M013:
    M013TW_1912
    MRSA252:
    SAR1966
    MSHR1132:
    SAMSHR1132_17210
    MSSA476:
    SAS1798
    Mu3:
    SAHV_1861
    Mu50:
    SAV1876
    MW2:
    MW1816
    RF122:
    SAB1808c
    ST398:
    SAPIG1969
    T0131:
    SAT0131_01999 (uvrB)
    TCH60:
    HMPREF0772_11268
    TW20:
    SATW20_18700
    USA300_TCH1516:
    USA300HOU_1871
    VC40:
    SAVC_08635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
    N315            MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
    NCTC8325        MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
    Newman          MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
    USA300_FPR3757  MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
                    *****************************************************