From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004894000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5092520..5092720
  • synteny block?: BlockID0038000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1836 (yfkK)
    08BA02176:
    C248_1952
    11819-97:
    MS7_1915
    71193:
    ST398NM01_1973
    ECT-R 2:
    ECTR2_1751
    ED133:
    SAOV_1978
    ED98:
    SAAV_1945
    HO 5096 0412:
    SAEMRSA15_17870
    JH1:
    SaurJH1_1968
    JH9:
    SaurJH9_1934
    JKD6008:
    SAA6008_01900
    JKD6159:
    SAA6159_01811
    LGA251:
    SARLGA251_17620
    M013:
    M013TW_1916
    MRSA252:
    SAR1970
    MSHR1132:
    SAMSHR1132_17250
    MSSA476:
    SAS1802
    Mu3:
    SAHV_1865
    Mu50:
    SAV1880
    MW2:
    MW1820
    RF122:
    SAB1812c
    ST398:
    SAPIG1973
    T0131:
    SAT0131_02003 (lgt)
    TCH60:
    HMPREF0772_11264
    TW20:
    SATW20_18740
    USA300_TCH1516:
    USA300HOU_1875
    VC40:
    SAVC_08655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIAD
    N315            MAMTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIAD
    NCTC8325        --MTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIAD
    Newman          --MTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIAD
    USA300_FPR3757  --MTNEEKVLAIREKLNIVNQGLLDPEKYKNANEEELTDIYDFVQSRERLSPSEVTAIAD
                      **********************************************************

    COL             ALGQLRHE
    N315            ALGQLRHD
    NCTC8325        ALGQLRHE
    Newman          ALGQLRHE
    USA300_FPR3757  ALGQLRHE
                    *******: