From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004899000
  • symbol?: vraR
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • DNA-binding response regulator VraR
    • two-component response regulator
    • Response regulator protein vraR
    • LuxR family two component transcriptional regulator
    • putative response regulator
    • response regulator receiver
    • two component LuxR family transcriptional regulator
    • Two component transcriptional regulator VraR, LuxR family
    • YvqC
  • strand?: -
  • coordinates?: 5095240..5095869
  • synteny block?: BlockID0038050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1942 (vraR)
    N315:
    SA1700 (vraR)
    NCTC8325:
    Newman:
    NWMN_1822 (vraR)
    USA300_FPR3757:
    04-02981:
    SA2981_1840 (vraR)
    08BA02176:
    C248_1956 (vraR)
    11819-97:
    MS7_1919 (vraR)
    71193:
    ST398NM01_1977
    ECT-R 2:
    ECTR2_1755
    ED133:
    SAOV_1982
    ED98:
    SAAV_1949 (vraR)
    HO 5096 0412:
    SAEMRSA15_17910
    JH1:
    SaurJH1_1972
    JH9:
    SaurJH9_1938
    JKD6008:
    SAA6008_01904 (vraR)
    JKD6159:
    SAA6159_01815 (vraR)
    LGA251:
    SARLGA251_17660 (vraR)
    M013:
    M013TW_1920
    MRSA252:
    SAR1974
    MSHR1132:
    SAMSHR1132_17290
    MSSA476:
    SAS1806
    Mu3:
    SAHV_1869 (vraR)
    Mu50:
    SAV1884 (vraR)
    MW2:
    MW1824 (vraR)
    RF122:
    SAB1816c
    ST398:
    SAPIG1977
    T0131:
    SAT0131_02008
    TCH60:
    HMPREF0772_11260 (vraR)
    TW20:
    SATW20_18780 (vraR)
    USA300_TCH1516:
    USA300HOU_1880 (vraR)
    VC40:
    SAVC_08675 (vraR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDD
    N315            MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMED
    NCTC8325        MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDD
    Newman          MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDD
    USA300_FPR3757  MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDD
                    **********************************************************:*

    COL             MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
    N315            MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
    NCTC8325        MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
    Newman          MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
    USA300_FPR3757  MDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTS
                    ************************************************************

    COL             RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
    N315            RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
    NCTC8325        RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
    Newman          RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
    USA300_FPR3757  RGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVK
                    ************************************************************

    COL             THVSNILSKLEVQDRTQAVIYAFQHNLIQ
    N315            THVSNILSKLEVQDRTQAVIYAFQHNLIQ
    NCTC8325        THVSNILSKLEVQDRTQAVIYAFQHNLIQ
    Newman          THVSNILSKLEVQDRTQAVIYAFQHNLIQ
    USA300_FPR3757  THVSNILSKLEVQDRTQAVIYAFQHNLIQ
                    *****************************