From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004907000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Integral membrane protein
    • protein in map 5'region
  • strand?: +
  • coordinates?: 5099926..5100912
  • synteny block?: BlockID0038130
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1845
    08BA02176:
    C248_1961
    11819-97:
    MS7_1924
    71193:
    ST398NM01_1982
    ECT-R 2:
    ECTR2_1760
    ED133:
    SAOV_1988
    ED98:
    SAAV_1954
    HO 5096 0412:
    SAEMRSA15_17960
    JH1:
    SaurJH1_1977
    JH9:
    SaurJH9_1943
    JKD6008:
    SAA6008_01909
    JKD6159:
    SAA6159_01820
    LGA251:
    SARLGA251_17710
    M013:
    M013TW_1925
    MRSA252:
    SAR1980
    MSHR1132:
    SAMSHR1132_17340
    MSSA476:
    SAS1811
    Mu3:
    SAHV_1874
    Mu50:
    SAV1889
    MW2:
    MW1829
    RF122:
    SAB1821
    ST398:
    SAPIG1982
    T0131:
    SAT0131_02014
    TCH60:
    HMPREF0772_11254
    TW20:
    SATW20_18830
    USA300_TCH1516:
    USA300HOU_1885
    VC40:
    SAVC_08700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR
    N315            MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR
    NCTC8325        MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR
    USA300_FPR3757  MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR
                    ************************************************************

    COL             LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI
    N315            LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI
    NCTC8325        LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI
    USA300_FPR3757  LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI
                    ************************************************************

    COL             HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL
    N315            HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL
    NCTC8325        HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL
    USA300_FPR3757  HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL
                    ************************************************************

    COL             ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL
    N315            ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL
    NCTC8325        ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL
    USA300_FPR3757  ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL
                    ************************************************************

    COL             FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL
    N315            FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGTFKREDDSVETLRSTIKAL
    NCTC8325        FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL
    USA300_FPR3757  FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL
                    *****************************************:******************

    COL             EISGENQIKSHILYEVLMIYRLLDSRYA
    N315            EISGENQIKSHILYEVLMIYRLLDSRYA
    NCTC8325        EISGENQIKSHILYEVLMIYRLLDSRYA
    USA300_FPR3757  EISGENQIKSHILYEVLMIYRLLDSRYA
                    ****************************