Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004926000
  • symbol?: gatB
  • description?: aspartyl/glutamyl-tRNA amidotransferase subunit B

      descriptions from strain specific annotations:

    • aspartyl/glutamyl-tRNA amidotransferase subunit B
    • Aspartyl-tRNA(Asn) amidotransferase subunit B
    • Glutamyl-tRNA(Gln) amidotransferase subunit B
    • glu-tRNAGln amidotransferase subunit B
    • aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B)
  • strand?: -
  • coordinates?: 5113622..5114989
  • synteny block?: BlockID0038320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1960 (gatB)
    N315:
    SA1715 (gatB)
    NCTC8325:
    Newman:
    NWMN_1837 (gatB)
    USA300_FPR3757:
    04-02981:
    SA2981_1856
    08BA02176:
    C248_1974 (gatB)
    11819-97:
    MS7_1934 (gatB)
    71193:
    ST398NM01_1993
    ECT-R 2:
    ECTR2_1771 (gatB)
    ED133:
    SAOV_1999
    ED98:
    SAAV_1965 (gatB)
    HO 5096 0412:
    SAEMRSA15_18060 (gatB)
    JH1:
    SaurJH1_1988 (gatB)
    JH9:
    SaurJH9_1954 (gatB)
    JKD6008:
    SAA6008_01920 (gatB)
    JKD6159:
    SAA6159_01830 (gatB)
    LGA251:
    SARLGA251_17820 (gatB)
    M013:
    M013TW_1936
    MRSA252:
    SAR1991 (gatB)
    MSHR1132:
    SAMSHR1132_17440
    MSSA476:
    SAS1822 (gatB)
    Mu3:
    SAHV_1884 (gatB)
    Mu50:
    SAV1899 (gatB)
    MW2:
    MW1840 (gatB)
    RF122:
    SAB1832c (gatB)
    ST398:
    SAPIG1993
    T0131:
    SAT0131_02025 (pgm)
    TCH60:
    HMPREF0772_11243 (gatB2)
    TW20:
    SATW20_18940 (gatB)
    USA300_TCH1516:
    USA300HOU_1900 (gatB)
    VC40:
    SAVC_08755 (gatB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
    N315            MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
    NCTC8325        MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
    Newman          MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
    USA300_FPR3757  MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
                    ************************************************************

    COL             RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
    N315            RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
    NCTC8325        RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
    Newman          RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
    USA300_FPR3757  RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
                    ************************************************************

    COL             LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
    N315            LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
    NCTC8325        LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
    Newman          LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
    USA300_FPR3757  LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
                    ************************************************************

    COL             DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
    N315            DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
    NCTC8325        DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
    Newman          DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
    USA300_FPR3757  DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
                    ************************************************************

    COL             IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
    N315            IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
    NCTC8325        IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
    Newman          IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
    USA300_FPR3757  IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
                    ************************************************************

    COL             AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
    N315            AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
    NCTC8325        AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
    Newman          AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
    USA300_FPR3757  AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
                    ************************************************************

    COL             DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
    N315            DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
    NCTC8325        DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
    Newman          DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
    USA300_FPR3757  DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
                    ************************************************************

    COL             FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
    N315            FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
    NCTC8325        FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
    Newman          FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
    USA300_FPR3757  FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
                    *******************************************************