From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004928000
  • symbol?: gatC
  • description?: aspartyl/glutamyl-tRNA amidotransferase subunit C

      descriptions from strain specific annotations:

    • aspartyl/glutamyl-tRNA amidotransferase subunit C
    • aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
    • Aspartyl-tRNA(Asn) amidotransferase subunit C
    • Glutamyl-tRNA(Gln) amidotransferase subunit C
    • bifunctional aspartyl/glutamyl-tRNA amidotransferase subunit C
    • glutamyl-tRNA(Gln) amidotransferase, C subunit
  • strand?: -
  • coordinates?: 5116521..5116823
  • synteny block?: BlockID0038340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1962 (gatC)
    N315:
    SA1717 (gatC)
    NCTC8325:
    Newman:
    NWMN_1839 (gatC)
    USA300_FPR3757:
    04-02981:
    SA2981_1858
    08BA02176:
    C248_1976 (gatC)
    11819-97:
    MS7_1936 (gatC)
    71193:
    ST398NM01_1995
    ECT-R 2:
    ECTR2_1773 (gatC)
    ED133:
    SAOV_2001
    ED98:
    SAAV_1967 (gatC)
    HO 5096 0412:
    SAEMRSA15_18080 (gatC)
    JH1:
    SaurJH1_1990 (gatC)
    JH9:
    SaurJH9_1956 (gatC)
    JKD6008:
    SAA6008_01922 (gatC)
    JKD6159:
    SAA6159_01832 (gatC)
    LGA251:
    SARLGA251_17840 (gatC)
    M013:
    M013TW_1938
    MRSA252:
    SAR1993 (gatC)
    MSHR1132:
    SAMSHR1132_17460
    MSSA476:
    SAS1824 (gatC)
    Mu3:
    SAHV_1886 (gatC)
    Mu50:
    SAV1901 (gatC)
    MW2:
    MW1842 (gatC)
    RF122:
    SAB1834c (gatC)
    ST398:
    SAPIG1995 (gatC)
    T0131:
    SAT0131_02027
    TCH60:
    HMPREF0772_11241 (gatC2)
    TW20:
    SATW20_18960 (gatC)
    USA300_TCH1516:
    USA300HOU_1902 (gatC)
    VC40:
    SAVC_08765 (gatC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
    N315            MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
    NCTC8325        MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
    Newman          MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
    USA300_FPR3757  MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
                    ************************************************************

    COL             NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA
    N315            NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA
    NCTC8325        NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA
    Newman          NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDL
    USA300_FPR3757  NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA
                    ***************************************