From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004932000
  • symbol?:
  • description?: sex pheromone staph-cAM373

      descriptions from strain specific annotations:

    • sex pheromone staph-cAM373
    • CamS sex pheromone cAM373 family protein
    • Putative pheromone cAM373 precursor lipoprotein CamS
    • CamS sex pheromone cAM373 precursor
    • pheromone lipoprotein CamS
    • putative lipoprotein
    • sex pheromone CamS
    • staphylococcal sex pheromone
    • Lipoprotein (pheromone precursor)
  • strand?: -
  • coordinates?: 5120688..5121887
  • synteny block?: BlockID0038370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1964 (camS)
    N315:
    NCTC8325:
    Newman:
    NWMN_1841 (camS)
    USA300_FPR3757:
    04-02981:
    SA2981_1860 (camS)
    08BA02176:
    C248_1978
    11819-97:
    MS7_1938
    71193:
    ST398NM01_1997
    ECT-R 2:
    ECTR2_1775
    ED133:
    SAOV_2005
    ED98:
    SAAV_1969 (camS)
    HO 5096 0412:
    SAEMRSA15_18100
    JH1:
    SaurJH1_1992
    JH9:
    SaurJH9_1958
    JKD6008:
    SAA6008_01924 (camS)
    JKD6159:
    SAA6159_01834 (camS)
    LGA251:
    SARLGA251_17880
    M013:
    M013TW_1940
    MRSA252:
    SAR1995
    MSHR1132:
    SAMSHR1132_17480
    MSSA476:
    SAS1826
    Mu3:
    SAHV_1888
    Mu50:
    SAV1903
    MW2:
    MW1844
    RF122:
    SAB1838c
    ST398:
    SAPIG1997
    T0131:
    SAT0131_02030 (secG)
    TCH60:
    HMPREF0772_11239 (camS)
    TW20:
    SATW20_18980
    USA300_TCH1516:
    USA300HOU_1904 (camS)
    VC40:
    SAVC_08775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRTLVLLITAIFILAACGNHKDDQAGKDNQKHNNSSNQVKEIATDKNVQGDNYRTLLPF
    N315            MKRTLVLLITAIFILAACGNHKDDQAGKDNQKHNNSSNQVKEIATDKNVQGDNYRTLLPF
    NCTC8325        MKRTLVLLITAIFILAACGNHKDDQAGKDNQKHNNSSNQVKEIATDKNVQGDNYRTLLPF
    Newman          MKRTLVLLITAIFILAACGNHKDDQAGKDNQKHNNSSNQVKEIATDKNVQGDNYRTLLPF
    USA300_FPR3757  MKRTLVLLITAIFILAACGNHKDDQAGKDNQKHNNSSNQVKEIATDKNVQGDNYRTLLPF
                    ************************************************************

    COL             KESQARGLLQDNMANSYNGGDFEDGLLNLSKEVFPTDKYLYQDGQFLDKKTINAYLNPKY
    N315            KESQARGLLQDNMANSYNGGDFEDGLLNLSKEVFPTDKYLYQDGQFLDKKTINAYLNPKY
    NCTC8325        KESQARGLLQDNMANSYNGGDFEDGLLNLSKEVFPTDKYLYQDGQFLDKKTINAYLNPKY
    Newman          KESQARGLLQDNMANSYNGGDFEDGLLNLSKEVFPTDKYLYQDGQFLDKKTINAYLNPKY
    USA300_FPR3757  KESQARGLLQDNMANSYNGGDFEDGLLNLSKEVFPTDKYLYQDGQFLDKKTINAYLNPKY
                    ************************************************************

    COL             TKREIDKMSEKDKKDKKANENLGLNPSHEGETDPEKIAEKSPAYLSNILEQDFYGGGDTK
    N315            TKREIDKMSEKDKKDKKANENLGLNPSHEGETNPEKIAEKSPAYLSNILEQDFYGGGDTK
    NCTC8325        TKREIDKMSEKDKKDKKANENLGLNPSHEGETDPEKIAEKSPAYLSNILEQDFYGGGDTK
    Newman          TKREIDKMSEKDKKDKKANENLGLNPSHEGETDPEKIAEKSPAYLSNILEQDFYGGGDTK
    USA300_FPR3757  TKREIDKMSEKDKKDKKANENLGLNPSHEGETDPEKIAEKSPAYLSNILEQDFYGGGDTK
                    ********************************:***************************

    COL             GKNIKGMTIGLAMNSVYYYKKEKDGSTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKD
    N315            GKNIKGMTIGLAMNSVYYYKKEKDGPTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKD
    NCTC8325        GKNIKGMTIGLAMNSVYYYKKEKDGSTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKD
    Newman          GKNIKGMTIGLAMNSVYYYKKEKDGSTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKD
    USA300_FPR3757  GKNIKGMTIGLAMNSVYYYKKEKDGSTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKD
                    *************************.**********************************

    COL             IPIHFAIYKQSSEDSITPGEFITQATAEKSQTKLNEWHNINEKSALLPSSTAADYDENLN
    N315            IPIHFAIYKQSSEDSITPGEFITQATAEKSQTKLNEWHNINEKSALLPSSTAADYDENLN
    NCTC8325        IPIHFAIYKQSSEDSITPGEFITQATAEKSQTKLNEWHNINEKSALLPSSTAADYDENLN
    Newman          IPIHFAIYKQSSEDSITPGEFITQATAEKSQTKLNEWHNINEKSALLPSSTAADYDENLN
    USA300_FPR3757  IPIHFAIYKQSSEDSITPGEFITQATAEKSQTKLNEWHNINEKSALLPSSTAADYDENLN
                    ************************************************************

    COL             NNFKQFNDNLQSYFSNFTQAVGKVKFVDKKPQRLVVDLPIDYYGQAETIGITQYVTEQAN
    N315            NNFKQFNDNLQSYFSNFTQAVGKVKFVDKKPQRLVVDLPIDYYGQAETIGITQYVTEQAN
    NCTC8325        NNFKQFNDNLQSYFSNFTQAVGKVKFVDKKPQRLVVDLPIDYYGQAETIGITQYVTEQAN
    Newman          NNFKQFNDNLQSYFSNFTQAVGKVKFVDKKPQRLVVDLPIDYYGQAETIGITQYVTEQAN
    USA300_FPR3757  NNFKQFNDNLQSYFSNFTQAVGKVKFVDKKPQRLVVDLPIDYYGQAETIGITQYVTEQAN
                    ************************************************************

    COL             KYFDKIDNYEIRIKDGNQPRALISKTKDDKEPQVHIYSN
    N315            KYFDKIDNYEIRIKDGNQPRALISKTKDDKEPQVHIYSN
    NCTC8325        KYFDKIDNYEIRIKDGNQPRALISKTKDDKEPQVHIYSN
    Newman          KYFDKIDNYEIRIKDGNQPRALISKTKDDKEPQVHIYSN
    USA300_FPR3757  KYFDKIDNYEIRIKDGNQPRALISKTKDDKEPQVHIYSN
                    ***************************************