From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004936000
  • symbol?: hisR
  • description?: His repressor

      descriptions from strain specific annotations:

    • His repressor
    • trp repressor family protein
    • putative DNA-binding protein
    • putative TrpR homolog YerC/YecD
    • Trp repressor protein
    • TrpR-like protein YerC/YecD
    • putative Trp repressor
    • cytosolic protein containing cobalamin binding site
    • sporulation protein YerC
  • strand?: -
  • coordinates?: 5126971..5127273
  • synteny block?: BlockID0038410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1864
    08BA02176:
    C248_1982
    11819-97:
    MS7_1942
    71193:
    ST398NM01_2001
    ECT-R 2:
    ECTR2_1779
    ED133:
    SAOV_2009
    ED98:
    SAAV_1973
    HO 5096 0412:
    SAEMRSA15_18140
    JH1:
    SaurJH1_1996
    JH9:
    SaurJH9_1962
    JKD6008:
    SAA6008_01928
    JKD6159:
    SAA6159_01838
    LGA251:
    SARLGA251_17920
    M013:
    M013TW_1944
    MRSA252:
    SAR1999
    MSHR1132:
    SAMSHR1132_17530
    MSSA476:
    SAS1830
    Mu3:
    SAHV_1892
    Mu50:
    SAV1907
    MW2:
    MW1848
    RF122:
    SAB1842c
    ST398:
    SAPIG2001
    T0131:
    SAT0131_02034
    TCH60:
    HMPREF0772_11235
    TW20:
    SATW20_19020
    USA300_TCH1516:
    USA300HOU_1908
    VC40:
    SAVC_08795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYA
    N315            MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYA
    NCTC8325        MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYA
    Newman          MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYA
    USA300_FPR3757  MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYA
                    ************************************************************

    COL             TIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
    N315            TIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
    NCTC8325        TIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
    Newman          TIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
    USA300_FPR3757  TIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
                    ****************************************