From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004952000
  • symbol?:
  • description?: parallel beta-helix repeat-containing protein

      descriptions from strain specific annotations:

    • parallel beta-helix repeat-containing protein
    • cell wall surface anchor family protein
    • pectate lyase superfamily protein
  • strand?: -
  • coordinates?: 5140248..5141333
  • synteny block?: BlockID0038560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1874
    08BA02176:
    C248_1994
    11819-97:
    MS7_1952
    71193:
    ST398NM01_2012
    ECT-R 2:
    ECTR2_1789
    ED133:
    SAOV_2020
    ED98:
    SAAV_1984
    HO 5096 0412:
    SAEMRSA15_18270
    JH1:
    SaurJH1_2007
    JH9:
    SaurJH9_1973
    JKD6008:
    SAA6008_01938
    JKD6159:
    SAA6159_01849
    LGA251:
    SARLGA251_18020
    M013:
    M013TW_1954
    MRSA252:
    SAR2010
    MSHR1132:
    SAMSHR1132_17620
    MSSA476:
    SAS1841
    Mu3:
    SAHV_1902
    Mu50:
    SAV1917
    MW2:
    MW1858
    RF122:
    SAB1854c
    ST398:
    SAPIG2012
    T0131:
    SAT0131_02046
    TCH60:
    HMPREF0772_11224
    TW20:
    SATW20_19120
    USA300_TCH1516:
    USA300HOU_1919
    VC40:
    SAVC_08850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYINMKDYGLTGINKTKDTRAIQRALNRGRCKPTTVYIPKGTYDICKPLTIYGNTTLLLD
    N315            MYINMKDYGLTGINKTKDTRAIQRALNRGRCKPTTVYIPKGTYDICKPLTIYGNTTLLLD
    NCTC8325        MYINMKDYGLTGINKTKDTRAIQRALNRGRCKPTTVYIPKGTYDICKPLTIYGNTTLLLD
    Newman          MYINMKDYGLTGINKTKDTRAIQRALNRGRCKPTTVYIPKGTYDICKPLTIYGNTTLLLD
    USA300_FPR3757  MYINMKDYGLTGINKTKDTRAIQRALNRGRCKPTTVYIPKGTYDICKPLTIYGNTTLLLD
                    ************************************************************

    COL             NETILRRCHSGPLLKNGRRFGFYRGYNGHSHIHIKGGKFDMNGVSYPYNNTAMCIGHAED
    N315            NETILRRCHSGPLLKNGHRFGFYRGYNGHSHIHIKGGKFDMNGVSYPYNNTAMCIGHAED
    NCTC8325        NETILRRCHSGPLLKNGRRFGFYRGYNGHSHIHIKGGKFDMNGVSYPYNNTAMCIGHAED
    Newman          NETILRRCHSGPLLKNGRRFGFYRGYNGHSHIHIKGGKFDMNGVSYPYNNTAMCIGHAED
    USA300_FPR3757  NETILRRCHSGPLLKNGRRFGFYRGYNGHSHIHIKGGKFDMNGVSYPYNNTAMCIGHAED
                    *****************:******************************************

    COL             IQLIGVTIKNVVSGHAIDACGINGLYIKSCSFEGFIDYSGERFYSEAIQLDIQVPGAFPK
    N315            IQLIGVTIKNVVSGHAIDACGINGLYIKSCSFEGFIDYSGERFYSEAIQLDIQVPGAFPK
    NCTC8325        IQLIGVTIKNVVSGHAIDACGINGLYIKSCSFEGFIDYSGERFYSEAIQLDIQVPGAFPK
    Newman          IQLIGVTIKNVVSGHAIDACGINGLYIKSCSFEGFIDYSGERFYSEAIQLDIQVPGAFPK
    USA300_FPR3757  IQLIGVTIKNVVSGHAIDACGINGLYIKSCSFEGFIDYSGERFYSEAIQLDIQVPGAFPK
                    ************************************************************

    COL             FGTTDGTITKNVIIEDCYFGPSELPEMGSWNRAIGSHASRHNRYYENIHIRNNIFEDIQG
    N315            FGTTDGTITKNVVIEDCYFGPSELPEMGSWNRAIGSHASRHNRYYENIHIRNNIFEDIQG
    NCTC8325        FGTTDGTITKNVIIEDCYFGPSELPEMGSWNRAIGSHASRHNRYYENIHIRNNIFEDIQG
    Newman          FGTTDGTITKNVIIEDCYFGPSELPEMGSWNRAIGSHASRHNRYYENIHIRNNIFEDIQG
    USA300_FPR3757  FGTTDGTITKNVIIEDCYFGPSELPEMGSWNRAIGSHASRHNRYYENIHIRNNIFEDIQG
                    ************:***********************************************

    COL             YALTPLKYKDAFIINNKFINCEGGIRYLGVRDGKNAADVMTGKDLGSQAGINMNIIGNEF
    N315            YALTPLKYKDAFIINNKFINCEGGIRYLGVRDGKNAADVMTGKDLGSQAGINMNIIGNEF
    NCTC8325        YALTPLKYKDAFIINNKFINCEGGIRYLGVRDGKNAADVMTGKDLGSQAGINMNIIGNEF
    Newman          YALTPLKYKDAFIINNKFINCEGGIRYLGVRDGKNAADVMTGKDLGSQAGINMNIIGNEF
    USA300_FPR3757  YALTPLKYKDAFIINNKFINCEGGIRYLGVRDGKNAADVMTGKDLGSQAGINMNIIGNEF
                    ************************************************************

    COL             KGSMSKDAIHVRNYNNVKHKDVLIVGNTFNNSTQSIHLEDIDTVFLSPVEAGIQVTTINV
    N315            KGSMSKDAIHVRNYNNVKHKDVLIVGNTFNNSTQSIHLEDIDTVFLSPVEAGIQVTTINI
    NCTC8325        KGSMSKDAIHVRNYNNVKHKDVLIVGNTFNNSTQSIHLEDIDTVFLSPVEAGIQVTTINV
    Newman          KGSMSKDAIHVRNYNNVKHKDVLIVGNTFNNSTQSIHLEDIDTVFLSPVEAGIQVTTINV
    USA300_FPR3757  KGSMSKDAIHVRNYNNVKHKDVLIVGNTFNNSTQSIHLEDIDTVFLSPVEAGIQVTTINV
                    ***********************************************************:

    COL             DEIKK
    N315            DEIKK
    NCTC8325        DEIKK
    Newman          DEIKK
    USA300_FPR3757  DEIKK
                    *****