From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004960000
  • symbol?:
  • description?: yolD-like family protein

      descriptions from strain specific annotations:

    • yolD-like family protein
    • pseudogene
  • strand?: +
  • coordinates?: 5147091..5159697
  • synteny block?: BlockID0038640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1880
    08BA02176:
    C248_2010
    11819-97:
    MS7_1958
    71193:
    ST398NM01_2026
    ECT-R 2:
    ECTR2_1795
    ED133:
    SAOV_2025
    ED98:
    SAAV_1990
    HO 5096 0412:
    SAEMRSA15_18390b (SAEMRSA15_18390)
    JH1:
    SaurJH1_2012
    JH9:
    SaurJH9_1979
    JKD6008:
    SAA6008_01944 (yolD)
    JKD6159:
    SAA6159_01854 (yolD)
    LGA251:
    SARLGA251_18070
    M013:
    M013TW_1960
    MRSA252:
    SAR2015
    MSHR1132:
    SAMSHR1132_17670
    MSSA476:
    SAS1846
    Mu3:
    SAHV_1907
    Mu50:
    SAV1922
    MW2:
    MW1863
    RF122:
    SAB1859
    ST398:
    SAPIG2026
    T0131:
    SAT0131_02053
    TCH60:
    HMPREF0772_11218
    TW20:
    SATW20_19170
    USA300_TCH1516:
    USA300HOU_1926
    VC40:
    SAVC_08875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSYEEETDYRNVPRELLDNNIPMGRGMIKWAPFATLPEQFETIQQYIIDQNKITRPVLS
    N315            MTSYEEETDYRNVPRELLDNNIPMGRGMIKWAPFATLPEQFETIQQYIIDQNKITRPVLS
    NCTC8325        MTSYEEETDYRNVPRELLDNNIPMGRGMIKWAPFATLPEQFETIQQYIIDQNKITRPVLS
    Newman          MTSYEEETDYRNVPRELLDNNIPMGRGMIKWAPFATLPEQFETIQQYIIDQNKITRPVLS
    USA300_FPR3757  MTSYEEETDYRNVPRELLDNNIPMGRGMIKWAPFATLPEQFETIQQYIIDQNKITRPVLS
                    ************************************************************

    COL             DDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYNQQQRQK
    N315            DDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYNQQQRQK
    NCTC8325        DDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYNQQQRQK
    Newman          DDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYNQQQRQK
    USA300_FPR3757  DDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYNQQQRQK
                    ************************************************************

    COL             ISIFDILDIVLLP
    N315            ISIFDILDIVLLP
    NCTC8325        ISIFDILDIVLLP
    Newman          ISIFDILDIVLLP
    USA300_FPR3757  ISIFDILDIVLLP
                    *************