From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004972000
  • symbol?:
  • description?: exported protein
  • strand?: -
  • coordinates?: 5160290..5160442
  • synteny block?: BlockID0038700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1882
    08BA02176:
    C248_2011
    11819-97:
    MS7_1959
    71193:
    ST398NM01_2027
    ECT-R 2:
    ECTR2_1796
    ED133:
    SAOV_2026
    ED98:
    SAAV_1991
    HO 5096 0412:
    SAEMRSA15_18400
    JH1:
    SaurJH1_2014
    JH9:
    SaurJH9_1981
    JKD6008:
    SAA6008_01945
    JKD6159:
    SAA6159_01855
    LGA251:
    SARLGA251_18080
    M013:
    M013TW_1961
    MRSA252:
    SAR2016
    MSHR1132:
    SAMSHR1132_17680
    MSSA476:
    SAS1848
    Mu3:
    SAHV_1909
    Mu50:
    SAV1924
    MW2:
    MW1865
    RF122:
    SAB1860c
    ST398:
    SAPIG2027
    T0131:
    SAT0131_02054
    TCH60:
    HMPREF0772_11217
    TW20:
    SATW20_19180
    USA300_TCH1516:
    USA300HOU_1927
    VC40:
    SAVC_08880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
    N315            MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
    NCTC8325        MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
    Newman          MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
    USA300_FPR3757  MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
                    *********************************************************