From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004974000
  • symbol?:
  • description?: exported protein
  • strand?: -
  • coordinates?: 5162013..5162630
  • synteny block?: BlockID0038720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1884
    08BA02176:
    C248_2013
    11819-97:
    MS7_1961
    71193:
    ST398NM01_2029
    ECT-R 2:
    ECTR2_1798
    ED133:
    SAOV_2028
    ED98:
    SAAV_1993
    HO 5096 0412:
    SAEMRSA15_18420
    JH1:
    SaurJH1_2016
    JH9:
    SaurJH9_1983
    JKD6008:
    SAA6008_01947
    JKD6159:
    SAA6159_01857
    LGA251:
    SARLGA251_18100
    M013:
    M013TW_1963
    MRSA252:
    SAR2018
    MSHR1132:
    SAMSHR1132_17700
    MSSA476:
    SAS1850
    Mu3:
    SAHV_1911
    Mu50:
    SAV1926
    MW2:
    MW1867
    RF122:
    SAB1862c
    ST398:
    SAPIG2029
    T0131:
    SAT0131_02056
    TCH60:
    HMPREF0772_11215
    TW20:
    SATW20_19200
    USA300_TCH1516:
    USA300HOU_1929
    VC40:
    SAVC_08890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKFFFIGLLVFVVFFTAATIIWFSYDKNKYGTKQYDKTFKDDAFDNVSINLDSTELRIK
    N315            MKKFFFIGLLVFVVFFTAATIIWFSYDKNKYGTKQYDKTFKDDAFDNVSINLDSTELRIK
    NCTC8325        MKKFFFIGLLVFVVFFTAATIIWFSYDKNKYGTKQYDKTFKDDAFDNVSINLDSTELRIK
    Newman          MKKFFFIGLLVFVVFFTAATIIWFSYDKNKYGTKQYDKTFKDDAFDNVSINLDSTELRIK
    USA300_FPR3757  MKKFFFIGLLVFVVFFTAATIIWFSYDKNKYGTKQYDKTFKDDAFDNVSINLDSTELRIK
                    ************************************************************

    COL             RGNQFRVKYDGDNDILINIVDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKMIK
    N315            RGNQFRVKYDGDNDILINIVDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKMIK
    NCTC8325        RGNQFRVKYDGDNDILINIVDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKMIK
    Newman          RGNQFRVKYDGDNDILINIVDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKMIK
    USA300_FPR3757  RGNQFRVKYDGDNDILINIVDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKMIK
                    ************************************************************

    COL             RLNLSSGAGSVRISDVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSN
    N315            RLNLSSGAGSVRISDVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSN
    NCTC8325        RLNLSSGAGSVRISDVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSN
    Newman          RLNLSSGAGSVRISDVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSN
    USA300_FPR3757  RLNLSSGAGSVRISDVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSN
                    ************************************************************

    COL             IKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKYDSKPEDTIL
    N315            IKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKYDSKPEDTIL
    NCTC8325        IKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKYDSKPEDTIL
    Newman          IKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKYDSKPEDTIL
    USA300_FPR3757  IKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKYDSKPEDTIL
                    ************************************************************

    COL             KLNPGTGDSVVKNKTFTNGKVGKSDNVLEFYTIDGNIKVE
    N315            KLNPGTGDSVVKNKTFTNGKVGKSDNVLEFYTIDGNIKVE
    NCTC8325        KLNPGTGDSVVKNKTFTNGKVGKSDNVLEFYTIDGNIKVE
    Newman          KLNPGTGDSVVKNKTFTNGKVGKSDNVLEFYTIDGNIKVE
    USA300_FPR3757  KLNPGTGDSVVKNKTFTNGKVGKSDNVLEFYTIDGNIKVE
                    ****************************************