From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004993000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 5176291..5176773
  • synteny block?: BlockID0038740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1885
    08BA02176:
    C248_2014
    11819-97:
    MS7_1962
    71193:
    ST398NM01_2048
    ECT-R 2:
    ECTR2_1799
    ED133:
    SAOV_2029
    ED98:
    SAAV_1994
    HO 5096 0412:
    SAEMRSA15_18430
    JH1:
    SaurJH1_2017
    JH9:
    SaurJH9_1984
    JKD6008:
    SAA6008_01948
    JKD6159:
    SAA6159_01858
    LGA251:
    SARLGA251_18110
    M013:
    M013TW_1964
    MRSA252:
    SAR2019
    MSHR1132:
    SAMSHR1132_17710
    MSSA476:
    SAS1851
    Mu3:
    SAHV_1912
    Mu50:
    SAV1927
    MW2:
    MW1868
    RF122:
    SAB1863c
    ST398:
    SAPIG2048
    T0131:
    SAT0131_02057
    TCH60:
    HMPREF0772_11214
    TW20:
    SATW20_19210
    USA300_TCH1516:
    USA300HOU_1930
    VC40:
    SAVC_08895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKITYLNELETALDALPRHLRDQKMYEYERYFYEQELNGVDEGEILKKLKDPQDVAAET
    N315            MNKITYLNELETALDALPRHLRDQKMYEYERYFYEQELNGVDEGEILKKLKDPQDVAAET
    NCTC8325        -------------------------MYEYERYFYEQELNGVDEGEILKKLKDPQDVAAET
    Newman          MNKITYLNELETALDALPRHLRDQKMYEYERYFYEQELNGVDEGEILKKLKDPQDVAAET
    USA300_FPR3757  MNKITYLNELETALDALPRHLRDQKMYEYERYFYEQELNGVDEGEILKKLKDPQDVAAET
                                             ***********************************

    COL             KARSVIDYAESKPTFENISRAVAASLSLGILSIFVILIPVSIVGLFVLALFLISLLLLFC
    N315            KARSVIDYAESKPTFENISRAVAASLSLGILSIFVILIPVSIVGLFVLALFLISLLLLFC
    NCTC8325        KARSVIDYAESKPTFENISRAVAASLSLGILSIFVILIPVSIVGLFVLALFLISLLLLFC
    Newman          KARSVIDYAESKPTFENISRAVAASLSLGILSIFVILIPVSIVGLFVLALFLISLLLLFC
    USA300_FPR3757  KARSVIDYAESKPTFENISRAVAASLSLGILSIFVILIPVSIVGLFVLALFLISLLLLFC
                    ************************************************************

    COL             PIILLASAISRGIVDSISNVFFAISYSGLGLVFIIVIFKILEYIYRLILKYLLWYIKTVK
    N315            PIILLASAISRGIVDSISNVFFAISYSGLGLVFIIVIFKILEYIYRLILKYLLWYIKTVK
    NCTC8325        PIILLASAISRGIVDSISNVFFAISYSGLGLVFIIVIFKILEYIYRLILKYLLWYIKTVK
    Newman          PIILLASAISRGIVDSISNVFFAISYSGLGLVFIIVIFKILEYIYRLILKYLLWYIKTVK
    USA300_FPR3757  PIILLASAISRGIVDSISNVFFAISYSGLGLVFIIVIFKILEYIYRLILKYLLWYIKTVK
                    ************************************************************

    COL             GSVRK
    N315            GSVRK
    NCTC8325        GSVRK
    Newman          GSVRK
    USA300_FPR3757  GSVRK
                    *****